Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074X3A1

Protein Details
Accession A0A074X3A1   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-49DMQKIHKPFRNPRWKPAQRRNKTVKQIVSHydrophilic
NLS Segment(s)
PositionSequence
30-40RNPRWKPAQRR
Subcellular Location(s) nucl 17.5, cyto_nucl 11, cyto 3.5, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MAPITTASDESNHMALLDKLDMQKIHKPFRNPRWKPAQRRNKTVKQIVSEAQRKEHQLLQQSVQPTRNNSAAATPQPEAAAPDPLPAQPIVTPTYTYTSIQAAPSFKPKQKYCDITGLPAPYSDPKTGLRYHNIEVYSLIKTLSTTQVQEYLAARGAHTILK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.13
5 0.13
6 0.13
7 0.16
8 0.18
9 0.2
10 0.27
11 0.32
12 0.4
13 0.42
14 0.5
15 0.57
16 0.67
17 0.75
18 0.72
19 0.75
20 0.77
21 0.82
22 0.84
23 0.85
24 0.85
25 0.82
26 0.88
27 0.88
28 0.86
29 0.86
30 0.83
31 0.77
32 0.7
33 0.66
34 0.6
35 0.6
36 0.57
37 0.49
38 0.45
39 0.43
40 0.4
41 0.39
42 0.38
43 0.32
44 0.33
45 0.34
46 0.32
47 0.32
48 0.32
49 0.33
50 0.33
51 0.31
52 0.26
53 0.26
54 0.26
55 0.24
56 0.21
57 0.2
58 0.18
59 0.18
60 0.18
61 0.16
62 0.14
63 0.14
64 0.13
65 0.13
66 0.11
67 0.12
68 0.09
69 0.09
70 0.09
71 0.09
72 0.1
73 0.08
74 0.08
75 0.06
76 0.08
77 0.09
78 0.09
79 0.1
80 0.1
81 0.13
82 0.14
83 0.14
84 0.13
85 0.13
86 0.14
87 0.14
88 0.15
89 0.14
90 0.14
91 0.22
92 0.26
93 0.28
94 0.35
95 0.37
96 0.41
97 0.48
98 0.52
99 0.48
100 0.53
101 0.5
102 0.45
103 0.47
104 0.42
105 0.34
106 0.29
107 0.26
108 0.2
109 0.23
110 0.2
111 0.19
112 0.2
113 0.24
114 0.29
115 0.32
116 0.35
117 0.36
118 0.37
119 0.4
120 0.37
121 0.34
122 0.3
123 0.28
124 0.23
125 0.19
126 0.16
127 0.11
128 0.12
129 0.14
130 0.18
131 0.18
132 0.18
133 0.19
134 0.23
135 0.24
136 0.26
137 0.24
138 0.21
139 0.24
140 0.22
141 0.2
142 0.18