FuNGI

A0A068RXW2

Protein Details

Accession

A0A068RXW2

Localization Confidence

Medium

Confidence Score

14.3

NoLS Segment(s)

Position	Sequence	Protein Nature
175-203	QRDRSRSRSPEPRERRPRQRTPERARASS	Basic

NLS Segment(s)

Position	Sequence
175-200	QRDRSRSRSPEPRERRPRQRTPERAR

Subcellular Location(s)

nucl 17, cyto 4, plas 3, cyto_mito 3

Family & Domain DBs

InterPro	View protein in InterPro IPR040366 Nab2/ZC3H14 IPR000571 Znf_CCCH
Gene Ontology	GO:0005634 C:nucleus GO:0046872 F:metal ion binding GO:0008143 F:poly(A) binding GO:1900364 P:negative regulation of mRNA polyadenylation GO:0043488 P:regulation of mRNA stability
Pfam	View protein in Pfam PF14608 zf-CCCH_2
PROSITE	View protein in PROSITE PS50103 ZF_C3H1

Amino Acid Sequences

MDRVIAEKDADVTSLIGRRKLWRCRSLLSTHTFSTPCRSKIGRHSQSNQLTIDPHNDTDYTLSEYITNLLQTGNQIDQINQELQQLVGSDYGNWNEWIALMVMVVIDRDELFIDVNLTAWMFSRIEEMQNPTPVKSAAPAPAAPQQQTSSPKPNRIFAQAIGGLNGGSSSSRRDQRDRSRSRSPEPRERRPRQRTPERARASSPSSSSSSFTILSRLGRSNDRQVSVASSDARPSVFDRLGAAKPSSTQTANRCKYWPACNQGEQCPYFHPKTICPDFPNCPKDASECMFIHPEVSPSQQQQQRGGPHPSASSIMTPPAKKPFPCRYFPYCTNPVCPFIHPDPSSMPMTPQQSSQPQQQQQQQQSSTPTKVPIPCKNGENCKRPGCHFLHPGEENPLADVLCKYDGACTRPNCFYKHTVPPMSHSGGNKSLILNKKNDMSQRQFSVQDDQVERMVVGESADLIKNNNGQAETATTTTSNGEPNAD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.2
2	0.22
3	0.22
4	0.25
5	0.34
6	0.42
7	0.52
8	0.59
9	0.62
10	0.64
11	0.68
12	0.72
13	0.7
14	0.68
15	0.65
16	0.6
17	0.53
18	0.53
19	0.48
20	0.42
21	0.45
22	0.44
23	0.39
24	0.4
25	0.41
26	0.43
27	0.53
28	0.63
29	0.63
30	0.65
31	0.68
32	0.72
33	0.76
34	0.74
35	0.64
36	0.55
37	0.48
38	0.41
39	0.41
40	0.34
41	0.28
42	0.25
43	0.24
44	0.22
45	0.22
46	0.21
47	0.2
48	0.18
49	0.17
50	0.15
51	0.16
52	0.16
53	0.15
54	0.13
55	0.09
56	0.08
57	0.09
58	0.1
59	0.12
60	0.11
61	0.14
62	0.15
63	0.15
64	0.17
65	0.2
66	0.2
67	0.18
68	0.18
69	0.15
70	0.14
71	0.15
72	0.13
73	0.1
74	0.11
75	0.1
76	0.1
77	0.11
78	0.13
79	0.13
80	0.13
81	0.12
82	0.1
83	0.1
84	0.1
85	0.09
86	0.07
87	0.05
88	0.05
89	0.05
90	0.05
91	0.05
92	0.04
93	0.04
94	0.04
95	0.04
96	0.05
97	0.05
98	0.06
99	0.06
100	0.07
101	0.06
102	0.07
103	0.07
104	0.06
105	0.06
106	0.06
107	0.08
108	0.07
109	0.08
110	0.1
111	0.11
112	0.14
113	0.16
114	0.22
115	0.23
116	0.3
117	0.3
118	0.27
119	0.28
120	0.26
121	0.24
122	0.2
123	0.19
124	0.17
125	0.19
126	0.19
127	0.2
128	0.26
129	0.28
130	0.27
131	0.25
132	0.22
133	0.25
134	0.31
135	0.33
136	0.37
137	0.39
138	0.47
139	0.48
140	0.51
141	0.49
142	0.48
143	0.45
144	0.35
145	0.37
146	0.32
147	0.3
148	0.26
149	0.23
150	0.17
151	0.14
152	0.13
153	0.07
154	0.04
155	0.05
156	0.08
157	0.13
158	0.2
159	0.24
160	0.29
161	0.39
162	0.5
163	0.6
164	0.65
165	0.67
166	0.71
167	0.72
168	0.75
169	0.76
170	0.73
171	0.73
172	0.73
173	0.77
174	0.78
175	0.82
176	0.86
177	0.85
178	0.88
179	0.87
180	0.89
181	0.89
182	0.87
183	0.88
184	0.83
185	0.76
186	0.68
187	0.62
188	0.56
189	0.48
190	0.4
191	0.32
192	0.29
193	0.27
194	0.26
195	0.22
196	0.19
197	0.17
198	0.15
199	0.14
200	0.13
201	0.13
202	0.14
203	0.16
204	0.16
205	0.19
206	0.21
207	0.28
208	0.3
209	0.29
210	0.28
211	0.26
212	0.26
213	0.23
214	0.22
215	0.15
216	0.12
217	0.12
218	0.12
219	0.11
220	0.1
221	0.1
222	0.13
223	0.11
224	0.11
225	0.12
226	0.15
227	0.16
228	0.17
229	0.16
230	0.12
231	0.13
232	0.14
233	0.15
234	0.12
235	0.15
236	0.21
237	0.31
238	0.34
239	0.35
240	0.35
241	0.36
242	0.39
243	0.42
244	0.42
245	0.38
246	0.39
247	0.43
248	0.45
249	0.47
250	0.48
251	0.41
252	0.36
253	0.32
254	0.33
255	0.28
256	0.29
257	0.25
258	0.23
259	0.31
260	0.35
261	0.34
262	0.32
263	0.36
264	0.37
265	0.44
266	0.45
267	0.37
268	0.34
269	0.31
270	0.31
271	0.31
272	0.28
273	0.26
274	0.23
275	0.23
276	0.24
277	0.23
278	0.21
279	0.17
280	0.16
281	0.12
282	0.14
283	0.15
284	0.15
285	0.23
286	0.25
287	0.27
288	0.29
289	0.33
290	0.36
291	0.4
292	0.42
293	0.36
294	0.34
295	0.33
296	0.3
297	0.26
298	0.21
299	0.17
300	0.14
301	0.17
302	0.19
303	0.2
304	0.21
305	0.27
306	0.3
307	0.3
308	0.38
309	0.44
310	0.46
311	0.51
312	0.56
313	0.55
314	0.6
315	0.64
316	0.63
317	0.6
318	0.57
319	0.56
320	0.52
321	0.49
322	0.42
323	0.38
324	0.36
325	0.31
326	0.38
327	0.33
328	0.32
329	0.3
330	0.32
331	0.33
332	0.27
333	0.26
334	0.22
335	0.25
336	0.24
337	0.23
338	0.24
339	0.29
340	0.32
341	0.38
342	0.43
343	0.45
344	0.51
345	0.57
346	0.61
347	0.62
348	0.66
349	0.59
350	0.53
351	0.55
352	0.53
353	0.48
354	0.41
355	0.37
356	0.35
357	0.39
358	0.44
359	0.45
360	0.47
361	0.48
362	0.52
363	0.57
364	0.62
365	0.65
366	0.65
367	0.64
368	0.65
369	0.65
370	0.62
371	0.64
372	0.58
373	0.57
374	0.56
375	0.52
376	0.52
377	0.5
378	0.49
379	0.46
380	0.42
381	0.34
382	0.28
383	0.25
384	0.17
385	0.16
386	0.14
387	0.11
388	0.1
389	0.11
390	0.1
391	0.14
392	0.19
393	0.22
394	0.29
395	0.3
396	0.34
397	0.42
398	0.45
399	0.43
400	0.44
401	0.47
402	0.47
403	0.54
404	0.58
405	0.56
406	0.54
407	0.56
408	0.58
409	0.55
410	0.51
411	0.43
412	0.4
413	0.38
414	0.39
415	0.35
416	0.3
417	0.34
418	0.38
419	0.41
420	0.39
421	0.38
422	0.41
423	0.45
424	0.51
425	0.52
426	0.52
427	0.54
428	0.56
429	0.57
430	0.55
431	0.52
432	0.52
433	0.47
434	0.47
435	0.42
436	0.38
437	0.35
438	0.33
439	0.3
440	0.23
441	0.19
442	0.12
443	0.1
444	0.08
445	0.08
446	0.1
447	0.11
448	0.11
449	0.12
450	0.15
451	0.18
452	0.2
453	0.22
454	0.2
455	0.2
456	0.21
457	0.23
458	0.23
459	0.2
460	0.19
461	0.16
462	0.17
463	0.19
464	0.19
465	0.18

A0A068RXW2

3D AlphaFold-predicted Structure Viewer