Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068RSS0

Protein Details
Accession A0A068RSS0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-84EELAQRKKAWKPKPPKYTKGAHydrophilic
NLS Segment(s)
PositionSequence
69-79RKKAWKPKPPK
Subcellular Location(s) cyto 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR042096  Dihydro-acid_dehy_C  
IPR000581  DiOHA_6PGluconate_deHydtase  
IPR020558  DiOHA_6PGluconate_deHydtase_CS  
Gene Ontology GO:0016836  F:hydro-lyase activity  
Pfam View protein in Pfam  
PF00920  ILVD_EDD  
PROSITE View protein in PROSITE  
PS00887  ILVD_EDD_2  
Amino Acid Sequences MGAGLGKDVALITDGRFSGASHGFIIGHICPEAQVGGPIALVQDGDEITIDATTRDIKVNVSDEELAQRKKAWKPKPPKYTKGALARYAMTVKSASEGAVTDEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.11
5 0.15
6 0.16
7 0.17
8 0.14
9 0.15
10 0.13
11 0.13
12 0.15
13 0.1
14 0.09
15 0.08
16 0.08
17 0.07
18 0.07
19 0.07
20 0.06
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.04
28 0.04
29 0.04
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.04
37 0.04
38 0.03
39 0.04
40 0.04
41 0.05
42 0.06
43 0.06
44 0.07
45 0.09
46 0.11
47 0.11
48 0.13
49 0.12
50 0.12
51 0.16
52 0.2
53 0.19
54 0.17
55 0.19
56 0.23
57 0.3
58 0.39
59 0.43
60 0.49
61 0.59
62 0.69
63 0.78
64 0.82
65 0.82
66 0.79
67 0.78
68 0.77
69 0.76
70 0.71
71 0.65
72 0.58
73 0.52
74 0.48
75 0.43
76 0.34
77 0.26
78 0.2
79 0.16
80 0.15
81 0.14
82 0.12
83 0.1
84 0.1