Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068RNN0

Protein Details
Accession A0A068RNN0   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPPKATRPKNTGNNTRQSRGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007218  DNA_pol_delta_4  
Gene Ontology GO:0006260  P:DNA replication  
GO:0000731  P:DNA synthesis involved in DNA repair  
Pfam View protein in Pfam  
PF04081  DNA_pol_delta_4  
Amino Acid Sequences MPPKATRPKNTGNNTRQSRGARSTMSKTNANQPKITDLGAATSKKGAVRKTRREGGIGSMMNLDKKPTEAPSSSPRVVGIHQEHLSQEEILLRKFDLDYKYGPCVGLTRMERWLRAEKLGLNPPKEVKEQLDRGAAKDSVLEDAWLHYSTSGEGQVVESEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.75
3 0.72
4 0.66
5 0.63
6 0.58
7 0.54
8 0.49
9 0.48
10 0.51
11 0.51
12 0.51
13 0.5
14 0.46
15 0.52
16 0.55
17 0.52
18 0.48
19 0.42
20 0.42
21 0.38
22 0.37
23 0.27
24 0.19
25 0.19
26 0.22
27 0.21
28 0.17
29 0.16
30 0.17
31 0.19
32 0.22
33 0.25
34 0.3
35 0.4
36 0.5
37 0.57
38 0.63
39 0.61
40 0.6
41 0.55
42 0.49
43 0.47
44 0.37
45 0.29
46 0.24
47 0.23
48 0.22
49 0.21
50 0.17
51 0.09
52 0.1
53 0.1
54 0.1
55 0.14
56 0.13
57 0.17
58 0.23
59 0.29
60 0.28
61 0.27
62 0.25
63 0.23
64 0.22
65 0.25
66 0.21
67 0.19
68 0.19
69 0.2
70 0.19
71 0.2
72 0.2
73 0.14
74 0.12
75 0.1
76 0.1
77 0.1
78 0.11
79 0.09
80 0.09
81 0.09
82 0.13
83 0.11
84 0.13
85 0.15
86 0.17
87 0.19
88 0.19
89 0.19
90 0.15
91 0.15
92 0.14
93 0.19
94 0.18
95 0.18
96 0.25
97 0.26
98 0.27
99 0.3
100 0.36
101 0.31
102 0.3
103 0.31
104 0.27
105 0.32
106 0.4
107 0.41
108 0.36
109 0.37
110 0.38
111 0.4
112 0.39
113 0.35
114 0.31
115 0.35
116 0.37
117 0.38
118 0.43
119 0.4
120 0.39
121 0.41
122 0.36
123 0.28
124 0.25
125 0.22
126 0.17
127 0.16
128 0.15
129 0.11
130 0.12
131 0.15
132 0.13
133 0.13
134 0.1
135 0.11
136 0.11
137 0.13
138 0.12
139 0.1
140 0.1
141 0.11