FuNGI

A0A068SG19

Protein Details

Accession

A0A068SG19

Localization Confidence

Medium

Confidence Score

11.3

NoLS Segment(s)

Position	Sequence	Protein Nature
4-49	TVKSSSQKFWHLKKIARKSSNPTTAHPPPPRSTIQQQQQQHRHRSL	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 24, cyto_nucl 14

Family & Domain DBs

InterPro	View protein in InterPro IPR027012 Enkurin_dom
Gene Ontology	GO:0005737 C:cytoplasm GO:0043227 C:membrane-bounded organelle
Pfam	View protein in Pfam PF13864 Enkurin

Amino Acid Sequences

MASTVKSSSQKFWHLKKIARKSSNPTTAHPPPPRSTIQQQQQQHRHRSLPNDNTSRRSSSPVEVLDSKAKNKQPAGSSLLSNRRLSSVSVPPDDVGEDNNERSNNTEKQQQHVATTTTATATLTKTTTQPSVAGSGNVAQNLQPMNNNAAKPRRGRMSEDSGTSTAAASTTTTRRSPPTASRPARPRSMVVRPAMSLDNLQSNMDDLQQPRVASLPTSPRSSALRTSKLPASPPLPASFKQQQQQQPAPKSSQNDIDEHRNDDYEAKIQYWMMQVEKERAVVSALQRQKEACNKDIEFLSQTVDEITHEKDMWKEKFESERINNERLQDDLSSTTDQLNEAREQVQQLFDDNQQLQSTMEEQRQQFDEQLLRQKEEMASSTTHHRSHDSNSTLQQQLRHSQDQVRMLKATMEQFLRMGIFSEDVSVYKDIAARYSTTLKASPIECLAEQHEQQQKQQRIETPPSPPMTAPHHHHHHHHNHHHSHQHEQQQHDNIQSPADLDIVLRKLLREKDILLVEYSKIPLSGVSALARRRREELEAQLDQIDSKVNKLKLTYRAYIKKY

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.67
2	0.72
3	0.76
4	0.81
5	0.82
6	0.81
7	0.81
8	0.79
9	0.82
10	0.84
11	0.76
12	0.7
13	0.68
14	0.68
15	0.71
16	0.7
17	0.66
18	0.61
19	0.64
20	0.64
21	0.62
22	0.62
23	0.62
24	0.64
25	0.66
26	0.7
27	0.74
28	0.8
29	0.82
30	0.83
31	0.79
32	0.77
33	0.73
34	0.75
35	0.74
36	0.74
37	0.75
38	0.76
39	0.74
40	0.72
41	0.71
42	0.67
43	0.58
44	0.54
45	0.48
46	0.42
47	0.45
48	0.41
49	0.42
50	0.38
51	0.4
52	0.42
53	0.42
54	0.41
55	0.41
56	0.44
57	0.45
58	0.47
59	0.49
60	0.45
61	0.48
62	0.51
63	0.46
64	0.45
65	0.46
66	0.51
67	0.5
68	0.47
69	0.42
70	0.37
71	0.36
72	0.35
73	0.33
74	0.32
75	0.33
76	0.34
77	0.34
78	0.32
79	0.32
80	0.3
81	0.24
82	0.18
83	0.17
84	0.17
85	0.17
86	0.21
87	0.2
88	0.2
89	0.22
90	0.27
91	0.27
92	0.27
93	0.34
94	0.33
95	0.38
96	0.46
97	0.44
98	0.4
99	0.39
100	0.38
101	0.3
102	0.29
103	0.25
104	0.17
105	0.16
106	0.13
107	0.12
108	0.11
109	0.12
110	0.12
111	0.13
112	0.14
113	0.17
114	0.18
115	0.18
116	0.18
117	0.17
118	0.19
119	0.19
120	0.17
121	0.15
122	0.16
123	0.16
124	0.16
125	0.15
126	0.11
127	0.13
128	0.13
129	0.14
130	0.12
131	0.13
132	0.17
133	0.21
134	0.22
135	0.25
136	0.31
137	0.35
138	0.37
139	0.41
140	0.44
141	0.43
142	0.49
143	0.5
144	0.52
145	0.51
146	0.49
147	0.48
148	0.4
149	0.38
150	0.31
151	0.24
152	0.15
153	0.11
154	0.09
155	0.06
156	0.09
157	0.11
158	0.15
159	0.16
160	0.18
161	0.21
162	0.24
163	0.28
164	0.34
165	0.41
166	0.48
167	0.51
168	0.57
169	0.63
170	0.65
171	0.65
172	0.58
173	0.52
174	0.48
175	0.53
176	0.51
177	0.45
178	0.42
179	0.36
180	0.37
181	0.34
182	0.27
183	0.2
184	0.15
185	0.15
186	0.14
187	0.14
188	0.11
189	0.11
190	0.11
191	0.11
192	0.13
193	0.11
194	0.14
195	0.16
196	0.16
197	0.15
198	0.16
199	0.15
200	0.12
201	0.15
202	0.2
203	0.21
204	0.23
205	0.23
206	0.24
207	0.27
208	0.28
209	0.32
210	0.3
211	0.33
212	0.32
213	0.35
214	0.37
215	0.36
216	0.36
217	0.32
218	0.28
219	0.25
220	0.25
221	0.25
222	0.24
223	0.24
224	0.29
225	0.31
226	0.33
227	0.35
228	0.41
229	0.43
230	0.48
231	0.54
232	0.55
233	0.54
234	0.53
235	0.52
236	0.48
237	0.45
238	0.4
239	0.4
240	0.34
241	0.31
242	0.31
243	0.35
244	0.33
245	0.33
246	0.31
247	0.23
248	0.22
249	0.2
250	0.19
251	0.14
252	0.13
253	0.11
254	0.11
255	0.11
256	0.12
257	0.13
258	0.13
259	0.1
260	0.11
261	0.12
262	0.14
263	0.15
264	0.14
265	0.12
266	0.11
267	0.11
268	0.12
269	0.13
270	0.17
271	0.2
272	0.2
273	0.21
274	0.21
275	0.24
276	0.29
277	0.31
278	0.26
279	0.29
280	0.28
281	0.3
282	0.29
283	0.27
284	0.22
285	0.18
286	0.16
287	0.1
288	0.1
289	0.08
290	0.08
291	0.07
292	0.07
293	0.08
294	0.08
295	0.08
296	0.09
297	0.12
298	0.19
299	0.2
300	0.22
301	0.22
302	0.24
303	0.29
304	0.32
305	0.36
306	0.32
307	0.4
308	0.41
309	0.43
310	0.42
311	0.38
312	0.36
313	0.29
314	0.27
315	0.17
316	0.15
317	0.13
318	0.13
319	0.12
320	0.12
321	0.12
322	0.11
323	0.11
324	0.11
325	0.12
326	0.11
327	0.11
328	0.12
329	0.12
330	0.13
331	0.13
332	0.14
333	0.11
334	0.13
335	0.14
336	0.13
337	0.17
338	0.16
339	0.16
340	0.15
341	0.15
342	0.14
343	0.12
344	0.14
345	0.13
346	0.15
347	0.19
348	0.19
349	0.21
350	0.23
351	0.23
352	0.22
353	0.22
354	0.22
355	0.21
356	0.3
357	0.29
358	0.28
359	0.27
360	0.28
361	0.26
362	0.24
363	0.22
364	0.16
365	0.15
366	0.15
367	0.23
368	0.25
369	0.26
370	0.25
371	0.26
372	0.26
373	0.3
374	0.37
375	0.34
376	0.33
377	0.34
378	0.39
379	0.4
380	0.39
381	0.38
382	0.33
383	0.36
384	0.39
385	0.39
386	0.36
387	0.38
388	0.42
389	0.46
390	0.46
391	0.42
392	0.36
393	0.34
394	0.33
395	0.3
396	0.27
397	0.23
398	0.2
399	0.18
400	0.17
401	0.18
402	0.16
403	0.13
404	0.12
405	0.09
406	0.08
407	0.08
408	0.09
409	0.09
410	0.09
411	0.11
412	0.11
413	0.1
414	0.1
415	0.13
416	0.12
417	0.13
418	0.14
419	0.13
420	0.16
421	0.2
422	0.2
423	0.2
424	0.21
425	0.21
426	0.23
427	0.22
428	0.21
429	0.19
430	0.2
431	0.18
432	0.19
433	0.21
434	0.22
435	0.22
436	0.28
437	0.34
438	0.33
439	0.39
440	0.47
441	0.49
442	0.49
443	0.54
444	0.53
445	0.53
446	0.59
447	0.59
448	0.55
449	0.55
450	0.54
451	0.5
452	0.43
453	0.4
454	0.39
455	0.41
456	0.41
457	0.43
458	0.48
459	0.5
460	0.55
461	0.61
462	0.65
463	0.69
464	0.73
465	0.74
466	0.74
467	0.78
468	0.8
469	0.72
470	0.7
471	0.67
472	0.66
473	0.62
474	0.59
475	0.6
476	0.59
477	0.6
478	0.55
479	0.51
480	0.42
481	0.37
482	0.32
483	0.25
484	0.18
485	0.16
486	0.12
487	0.09
488	0.13
489	0.13
490	0.15
491	0.14
492	0.15
493	0.21
494	0.26
495	0.29
496	0.27
497	0.28
498	0.33
499	0.36
500	0.36
501	0.32
502	0.29
503	0.27
504	0.26
505	0.26
506	0.19
507	0.15
508	0.14
509	0.12
510	0.13
511	0.14
512	0.14
513	0.16
514	0.2
515	0.27
516	0.34
517	0.38
518	0.38
519	0.41
520	0.42
521	0.45
522	0.47
523	0.51
524	0.53
525	0.5
526	0.49
527	0.46
528	0.42
529	0.36
530	0.29
531	0.26
532	0.18
533	0.21
534	0.27
535	0.28
536	0.3
537	0.34
538	0.41
539	0.44
540	0.51
541	0.54
542	0.56

A0A068SG19

3D AlphaFold-predicted Structure Viewer