Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A068RZV1

Protein Details
Accession A0A068RZV1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
25-45TPFRCLKKTRHARLGNPKKINHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, mito 6, E.R. 4, golg 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRSTLFVSIIGFSLVLVLPERIHVTPFRCLKKTRHARLGNPKKINMRLCTFWALFFFISFLRDTHTHTHTHTHPPITHTSTCGIQQHTFSTRLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.07
6 0.08
7 0.11
8 0.1
9 0.12
10 0.15
11 0.16
12 0.24
13 0.31
14 0.36
15 0.37
16 0.41
17 0.45
18 0.53
19 0.61
20 0.62
21 0.65
22 0.65
23 0.7
24 0.77
25 0.82
26 0.81
27 0.74
28 0.69
29 0.64
30 0.65
31 0.61
32 0.53
33 0.45
34 0.38
35 0.36
36 0.36
37 0.31
38 0.25
39 0.21
40 0.18
41 0.15
42 0.13
43 0.11
44 0.07
45 0.09
46 0.09
47 0.08
48 0.1
49 0.11
50 0.14
51 0.19
52 0.21
53 0.21
54 0.22
55 0.28
56 0.28
57 0.37
58 0.38
59 0.38
60 0.38
61 0.4
62 0.45
63 0.45
64 0.43
65 0.35
66 0.34
67 0.31
68 0.32
69 0.33
70 0.31
71 0.27
72 0.28
73 0.31
74 0.33