FuNGI

Q6CA99

Protein Details

Accession

Q6CA99

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
13-42	RLPLVFSRDYHKKRRQMKQKDLEKESRQDA	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 19, cyto 6, cyto_nucl 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR031167 G_OBG IPR006073 GTP-bd IPR014100 GTP-bd_Obg/CgtA IPR006169 GTP1_OBG_dom IPR036726 GTP1_OBG_dom_sf IPR045086 OBG_GTPase IPR027417 P-loop_NTPase
Gene Ontology	GO:0005739 C:mitochondrion GO:0005525 F:GTP binding GO:0003924 F:GTPase activity GO:0000287 F:magnesium ion binding GO:0042254 P:ribosome biogenesis
KEGG	yli:YALI0D04697g -
Pfam	View protein in Pfam PF01018 GTP1_OBG PF01926 MMR_HSR1
PROSITE	View protein in PROSITE PS51710 G_OBG PS51883 OBG
CDD	cd01898 Obg

Amino Acid Sequences

MLTSRTPGVGRLRLPLVFSRDYHKKRRQMKQKDLEKESRQDAVQRFFDKDQKRFAVMPYKSPYDAVKYHEAQQAVKDGSHFLDVRLVKCSAGKGGNGRVSFAREAMMPYGPADGGDGGEGGSVYIQAVDSIRTLKNLSFKYMAGAGKAGGSSHMYGHRGTDVLLQVPVGTVVKWCPDPKRDVEQDLIKVDPEEAARKYPPQFLENGEPVPDHKEVVGVEVAEGMFHMNRGYLRLNRATMADGEGWTYENPQVANWCNDPKNPPEFFTRTKEATKFDDAVLRSTEEATDVFPVDGLDLCEPGKPPQLLLKGGAGGAGNMRYHRDDIRNPKFAKLGRSGITATFMLELKLLADLGLVGLPNAGKSTLLGAISRASPRVGHWEFTTLHPTIGTISVGMDKPSFTVADIPGIIKGARINKGMGLDFLRHVERSNGLVFVIALDRPDPVSDLRVLIGELGPERMAGKSVLVVATKADVEESERRFIDLNAFVSNKNWAIVPCSAMNAENVQPVINEMAKVAGVYGTNTILEG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.4
2	0.4
3	0.39
4	0.36
5	0.36
6	0.39
7	0.46
8	0.52
9	0.6
10	0.64
11	0.67
12	0.74
13	0.83
14	0.86
15	0.87
16	0.9
17	0.9
18	0.91
19	0.92
20	0.9
21	0.89
22	0.86
23	0.81
24	0.74
25	0.68
26	0.59
27	0.57
28	0.54
29	0.52
30	0.51
31	0.47
32	0.47
33	0.47
34	0.55
35	0.55
36	0.54
37	0.56
38	0.53
39	0.54
40	0.51
41	0.53
42	0.54
43	0.48
44	0.51
45	0.48
46	0.48
47	0.44
48	0.44
49	0.41
50	0.37
51	0.38
52	0.35
53	0.37
54	0.35
55	0.41
56	0.43
57	0.43
58	0.37
59	0.37
60	0.38
61	0.31
62	0.29
63	0.23
64	0.21
65	0.21
66	0.24
67	0.22
68	0.16
69	0.22
70	0.23
71	0.24
72	0.26
73	0.25
74	0.21
75	0.22
76	0.23
77	0.21
78	0.21
79	0.23
80	0.24
81	0.31
82	0.36
83	0.35
84	0.35
85	0.31
86	0.33
87	0.31
88	0.27
89	0.2
90	0.15
91	0.17
92	0.17
93	0.16
94	0.12
95	0.12
96	0.12
97	0.11
98	0.1
99	0.09
100	0.07
101	0.07
102	0.06
103	0.06
104	0.05
105	0.05
106	0.05
107	0.04
108	0.03
109	0.03
110	0.03
111	0.03
112	0.03
113	0.04
114	0.04
115	0.05
116	0.06
117	0.09
118	0.1
119	0.11
120	0.13
121	0.14
122	0.22
123	0.22
124	0.26
125	0.24
126	0.24
127	0.25
128	0.29
129	0.27
130	0.2
131	0.19
132	0.15
133	0.14
134	0.14
135	0.12
136	0.07
137	0.08
138	0.08
139	0.1
140	0.13
141	0.14
142	0.14
143	0.15
144	0.15
145	0.13
146	0.13
147	0.15
148	0.13
149	0.13
150	0.13
151	0.12
152	0.11
153	0.1
154	0.1
155	0.06
156	0.05
157	0.05
158	0.06
159	0.08
160	0.11
161	0.14
162	0.18
163	0.22
164	0.27
165	0.32
166	0.4
167	0.41
168	0.41
169	0.43
170	0.43
171	0.42
172	0.39
173	0.34
174	0.25
175	0.22
176	0.19
177	0.16
178	0.12
179	0.13
180	0.12
181	0.15
182	0.16
183	0.19
184	0.21
185	0.25
186	0.26
187	0.24
188	0.25
189	0.25
190	0.3
191	0.28
192	0.27
193	0.22
194	0.2
195	0.19
196	0.21
197	0.18
198	0.12
199	0.1
200	0.11
201	0.1
202	0.12
203	0.12
204	0.08
205	0.07
206	0.08
207	0.07
208	0.06
209	0.06
210	0.04
211	0.04
212	0.04
213	0.04
214	0.04
215	0.05
216	0.07
217	0.1
218	0.12
219	0.16
220	0.19
221	0.19
222	0.19
223	0.2
224	0.18
225	0.16
226	0.15
227	0.12
228	0.1
229	0.09
230	0.09
231	0.09
232	0.08
233	0.09
234	0.07
235	0.08
236	0.08
237	0.07
238	0.1
239	0.11
240	0.13
241	0.14
242	0.17
243	0.17
244	0.19
245	0.22
246	0.23
247	0.28
248	0.27
249	0.27
250	0.29
251	0.32
252	0.34
253	0.37
254	0.37
255	0.33
256	0.36
257	0.36
258	0.34
259	0.33
260	0.32
261	0.28
262	0.25
263	0.26
264	0.23
265	0.23
266	0.21
267	0.17
268	0.14
269	0.13
270	0.12
271	0.08
272	0.08
273	0.07
274	0.07
275	0.06
276	0.06
277	0.06
278	0.06
279	0.05
280	0.06
281	0.06
282	0.05
283	0.06
284	0.06
285	0.07
286	0.08
287	0.09
288	0.13
289	0.12
290	0.13
291	0.18
292	0.21
293	0.21
294	0.21
295	0.21
296	0.17
297	0.16
298	0.17
299	0.11
300	0.08
301	0.08
302	0.08
303	0.07
304	0.07
305	0.09
306	0.09
307	0.11
308	0.15
309	0.19
310	0.25
311	0.35
312	0.43
313	0.5
314	0.5
315	0.5
316	0.51
317	0.49
318	0.48
319	0.42
320	0.39
321	0.32
322	0.34
323	0.32
324	0.28
325	0.28
326	0.22
327	0.17
328	0.13
329	0.12
330	0.1
331	0.09
332	0.08
333	0.06
334	0.06
335	0.05
336	0.04
337	0.04
338	0.03
339	0.03
340	0.04
341	0.03
342	0.03
343	0.04
344	0.04
345	0.04
346	0.04
347	0.04
348	0.04
349	0.04
350	0.06
351	0.08
352	0.08
353	0.08
354	0.09
355	0.1
356	0.12
357	0.13
358	0.12
359	0.11
360	0.11
361	0.12
362	0.21
363	0.21
364	0.21
365	0.21
366	0.25
367	0.26
368	0.28
369	0.31
370	0.22
371	0.2
372	0.19
373	0.18
374	0.14
375	0.14
376	0.12
377	0.07
378	0.07
379	0.1
380	0.11
381	0.12
382	0.11
383	0.1
384	0.1
385	0.11
386	0.11
387	0.08
388	0.11
389	0.11
390	0.13
391	0.13
392	0.13
393	0.12
394	0.13
395	0.13
396	0.1
397	0.13
398	0.16
399	0.19
400	0.2
401	0.21
402	0.22
403	0.25
404	0.25
405	0.24
406	0.2
407	0.18
408	0.18
409	0.2
410	0.2
411	0.17
412	0.18
413	0.18
414	0.17
415	0.18
416	0.19
417	0.16
418	0.14
419	0.14
420	0.13
421	0.12
422	0.12
423	0.09
424	0.08
425	0.08
426	0.08
427	0.09
428	0.09
429	0.1
430	0.1
431	0.12
432	0.13
433	0.14
434	0.13
435	0.13
436	0.13
437	0.12
438	0.12
439	0.1
440	0.1
441	0.1
442	0.1
443	0.09
444	0.1
445	0.09
446	0.1
447	0.09
448	0.09
449	0.09
450	0.11
451	0.12
452	0.12
453	0.12
454	0.11
455	0.13
456	0.12
457	0.11
458	0.1
459	0.08
460	0.13
461	0.2
462	0.23
463	0.27
464	0.27
465	0.28
466	0.28
467	0.29
468	0.31
469	0.28
470	0.27
471	0.26
472	0.28
473	0.27
474	0.27
475	0.31
476	0.24
477	0.2
478	0.2
479	0.15
480	0.19
481	0.2
482	0.23
483	0.2
484	0.21
485	0.21
486	0.2
487	0.22
488	0.2
489	0.2
490	0.19
491	0.19
492	0.17
493	0.16
494	0.17
495	0.19
496	0.16
497	0.15
498	0.12
499	0.13
500	0.12
501	0.12
502	0.11
503	0.09
504	0.08
505	0.09
506	0.11
507	0.11

Q6CA99

3D AlphaFold-predicted Structure Viewer