Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A068RZ66

Protein Details
Accession A0A068RZ66    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
81-106LQNLNQKKGLSREKKRRIEELFNKCKHydrophilic
NLS Segment(s)
PositionSequence
88-97KGLSREKKRR
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
Amino Acid Sequences MQNAMLSFLLVLNRLVPQLPCSQTPFPKRLVSNRFVMEPSYLEATPWTEWSYDDYKEFRQRHAPRRIPREKVLLSDFRLKLQNLNQKKGLSREKKRRIEELFNKCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.13
5 0.19
6 0.21
7 0.23
8 0.28
9 0.33
10 0.39
11 0.45
12 0.44
13 0.42
14 0.45
15 0.46
16 0.5
17 0.52
18 0.47
19 0.47
20 0.46
21 0.43
22 0.37
23 0.35
24 0.26
25 0.2
26 0.18
27 0.15
28 0.13
29 0.11
30 0.11
31 0.12
32 0.11
33 0.12
34 0.11
35 0.08
36 0.08
37 0.12
38 0.14
39 0.13
40 0.15
41 0.15
42 0.18
43 0.27
44 0.28
45 0.27
46 0.35
47 0.42
48 0.5
49 0.59
50 0.64
51 0.64
52 0.74
53 0.8
54 0.75
55 0.72
56 0.7
57 0.61
58 0.57
59 0.54
60 0.48
61 0.43
62 0.46
63 0.42
64 0.37
65 0.39
66 0.35
67 0.34
68 0.38
69 0.44
70 0.42
71 0.48
72 0.49
73 0.48
74 0.52
75 0.56
76 0.58
77 0.59
78 0.63
79 0.68
80 0.75
81 0.82
82 0.84
83 0.84
84 0.82
85 0.82
86 0.82