Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068S268

Protein Details
Accession A0A068S268    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-31ARTPTISFRERRSRRRARNSEDEEGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 9, cyto_nucl 9, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MCVVVARTPTISFRERRSRRRARNSEDEEGLNGPQDAGMQGSQQRDVAISMHRMGDHSNNNDTSSTSYPPPTYQESRKDSLVLPTTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.52
3 0.6
4 0.68
5 0.75
6 0.8
7 0.88
8 0.89
9 0.87
10 0.89
11 0.87
12 0.81
13 0.73
14 0.62
15 0.52
16 0.43
17 0.35
18 0.24
19 0.16
20 0.1
21 0.07
22 0.07
23 0.05
24 0.05
25 0.05
26 0.05
27 0.08
28 0.09
29 0.09
30 0.09
31 0.09
32 0.09
33 0.09
34 0.09
35 0.08
36 0.09
37 0.1
38 0.1
39 0.1
40 0.1
41 0.11
42 0.16
43 0.19
44 0.21
45 0.24
46 0.24
47 0.25
48 0.25
49 0.25
50 0.24
51 0.21
52 0.21
53 0.19
54 0.2
55 0.21
56 0.22
57 0.25
58 0.28
59 0.33
60 0.37
61 0.45
62 0.49
63 0.51
64 0.51
65 0.5
66 0.44
67 0.46