Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C2P1

Protein Details
Accession Q6C2P1    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
180-208GLTHGLRKIKKDKKDKKDKKKKEYKVVKPBasic
NLS Segment(s)
PositionSequence
185-208LRKIKKDKKDKKDKKKKEYKVVKP
Subcellular Location(s) nucl 15.5, mito_nucl 9, cyto 6, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
GO:0071171  P:site-specific DNA replication termination at RTS1 barrier  
KEGG yli:YALI0F06270g  -  
Pfam View protein in Pfam  
PF04641  Rtf2  
Amino Acid Sequences MGNDGGSIPTRRDLVKDKQNGLTTSQLFDATQDNADFDWKNCPVSKKSLQQPIVSDYKGRLYNKDAVLEWLLDKDESSVAAQVIPHIQSVKDIVELHFETSKDGDWICPLSQREVKALTYRFVYVAESGWVYSESAIKEFKECPQTSVPFSDKNLVLINPIREEDKLAAKARLDRLTEEGLTHGLRKIKKDKKDKKDKKKKEYKVVKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.45
3 0.51
4 0.53
5 0.58
6 0.63
7 0.59
8 0.55
9 0.53
10 0.44
11 0.38
12 0.34
13 0.28
14 0.22
15 0.22
16 0.21
17 0.15
18 0.15
19 0.13
20 0.13
21 0.12
22 0.15
23 0.15
24 0.13
25 0.19
26 0.18
27 0.21
28 0.23
29 0.28
30 0.29
31 0.36
32 0.43
33 0.45
34 0.53
35 0.59
36 0.6
37 0.58
38 0.57
39 0.54
40 0.51
41 0.43
42 0.36
43 0.27
44 0.29
45 0.32
46 0.3
47 0.27
48 0.27
49 0.34
50 0.35
51 0.36
52 0.31
53 0.27
54 0.27
55 0.25
56 0.2
57 0.14
58 0.12
59 0.1
60 0.09
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.06
67 0.07
68 0.07
69 0.07
70 0.08
71 0.08
72 0.08
73 0.07
74 0.07
75 0.07
76 0.09
77 0.08
78 0.09
79 0.09
80 0.09
81 0.13
82 0.13
83 0.14
84 0.14
85 0.14
86 0.13
87 0.12
88 0.12
89 0.09
90 0.09
91 0.07
92 0.06
93 0.08
94 0.08
95 0.11
96 0.11
97 0.15
98 0.17
99 0.18
100 0.19
101 0.19
102 0.2
103 0.22
104 0.22
105 0.2
106 0.18
107 0.18
108 0.17
109 0.15
110 0.15
111 0.1
112 0.09
113 0.09
114 0.08
115 0.07
116 0.07
117 0.07
118 0.06
119 0.06
120 0.08
121 0.08
122 0.09
123 0.11
124 0.1
125 0.12
126 0.13
127 0.18
128 0.25
129 0.25
130 0.27
131 0.32
132 0.34
133 0.34
134 0.39
135 0.37
136 0.3
137 0.32
138 0.33
139 0.28
140 0.27
141 0.26
142 0.21
143 0.22
144 0.22
145 0.23
146 0.19
147 0.2
148 0.19
149 0.17
150 0.2
151 0.19
152 0.21
153 0.25
154 0.25
155 0.27
156 0.28
157 0.34
158 0.37
159 0.4
160 0.36
161 0.33
162 0.34
163 0.36
164 0.34
165 0.29
166 0.24
167 0.21
168 0.2
169 0.19
170 0.19
171 0.21
172 0.23
173 0.3
174 0.4
175 0.46
176 0.55
177 0.66
178 0.73
179 0.78
180 0.87
181 0.91
182 0.92
183 0.95
184 0.96
185 0.96
186 0.96
187 0.96
188 0.95