Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068S0G7

Protein Details
Accession A0A068S0G7   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
85-117LLDEKKQKQKTTRPSNRQYHRKKNREAIKAMNFHydrophilic
NLS Segment(s)
PositionSequence
94-111KTTRPSNRQYHRKKNREA
Subcellular Location(s) mito 17.5, cyto_mito 9.5, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFLQLARPLGIVRRVAPRIQCNFHYAAVIRNAEATSEKESVKPASSRPASSVPKGTVLKGINYLKDGKDPVALDDSEYPDWLWDLLDEKKQKQKTTRPSNRQYHRKKNREAIKAMNFMKDKKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.41
4 0.45
5 0.48
6 0.51
7 0.49
8 0.45
9 0.45
10 0.42
11 0.38
12 0.3
13 0.27
14 0.27
15 0.25
16 0.21
17 0.2
18 0.19
19 0.17
20 0.18
21 0.16
22 0.15
23 0.16
24 0.17
25 0.16
26 0.18
27 0.19
28 0.21
29 0.2
30 0.17
31 0.24
32 0.26
33 0.26
34 0.27
35 0.33
36 0.34
37 0.34
38 0.36
39 0.28
40 0.32
41 0.32
42 0.29
43 0.26
44 0.24
45 0.23
46 0.25
47 0.25
48 0.2
49 0.2
50 0.22
51 0.17
52 0.18
53 0.18
54 0.13
55 0.14
56 0.14
57 0.14
58 0.14
59 0.14
60 0.13
61 0.14
62 0.17
63 0.14
64 0.14
65 0.13
66 0.1
67 0.1
68 0.09
69 0.07
70 0.05
71 0.08
72 0.1
73 0.17
74 0.2
75 0.24
76 0.32
77 0.37
78 0.43
79 0.49
80 0.56
81 0.61
82 0.69
83 0.77
84 0.79
85 0.84
86 0.89
87 0.9
88 0.91
89 0.91
90 0.91
91 0.91
92 0.91
93 0.9
94 0.9
95 0.89
96 0.87
97 0.82
98 0.81
99 0.79
100 0.78
101 0.7
102 0.68
103 0.61