Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CAD3

Protein Details
Accession Q6CAD3    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
97-116IRKTRVPKRYWNKTLREVQAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito_nucl 11.833, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018851  Borealin_N  
KEGG yli:YALI0D03784g  -  
Pfam View protein in Pfam  
PF10444  Nbl1_Borealin_N  
Amino Acid Sequences MTTSPAHSTQHTSPTFSTFTMPTEMDQFPSNMARKPLTEVQKNDLIENLQLEREYRDSIQRAQHTNRLGINTVTNRIERLKSQYQFAAQAVRAKIEIRKTRVPKRYWNKTLREVQALQDGALKDRKPNKLNFGQGFHNIPKFTIPHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.31
4 0.29
5 0.21
6 0.22
7 0.21
8 0.21
9 0.17
10 0.21
11 0.21
12 0.19
13 0.19
14 0.18
15 0.16
16 0.22
17 0.23
18 0.21
19 0.23
20 0.23
21 0.23
22 0.28
23 0.34
24 0.36
25 0.42
26 0.42
27 0.43
28 0.48
29 0.47
30 0.41
31 0.35
32 0.28
33 0.21
34 0.2
35 0.16
36 0.1
37 0.1
38 0.1
39 0.11
40 0.11
41 0.12
42 0.12
43 0.16
44 0.18
45 0.21
46 0.27
47 0.3
48 0.34
49 0.35
50 0.39
51 0.36
52 0.36
53 0.33
54 0.29
55 0.25
56 0.21
57 0.21
58 0.17
59 0.18
60 0.17
61 0.15
62 0.15
63 0.16
64 0.16
65 0.14
66 0.21
67 0.26
68 0.26
69 0.27
70 0.28
71 0.27
72 0.28
73 0.27
74 0.24
75 0.17
76 0.21
77 0.19
78 0.18
79 0.17
80 0.16
81 0.19
82 0.24
83 0.3
84 0.31
85 0.4
86 0.47
87 0.57
88 0.64
89 0.66
90 0.68
91 0.72
92 0.77
93 0.78
94 0.79
95 0.76
96 0.76
97 0.8
98 0.74
99 0.7
100 0.6
101 0.53
102 0.51
103 0.44
104 0.35
105 0.31
106 0.26
107 0.23
108 0.27
109 0.25
110 0.26
111 0.34
112 0.42
113 0.44
114 0.5
115 0.56
116 0.6
117 0.69
118 0.67
119 0.63
120 0.59
121 0.57
122 0.57
123 0.53
124 0.49
125 0.4
126 0.35
127 0.35