Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A068SDA0

Protein Details
Accession A0A068SDA0    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
34-55ALVRYLRYRNINKLRRKYPDPTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14, mito 8, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046366  MPAB  
Gene Ontology GO:0016020  C:membrane  
GO:0016301  F:kinase activity  
GO:0016491  F:oxidoreductase activity  
GO:0016310  P:phosphorylation  
Amino Acid Sequences MDSVIASLSKWLSVKDNRVLLWQAAATTSILYLALVRYLRYRNINKLRRKYPDPTIALKDHAVAEEVFDTTVRREFPFLARQALELALFKTYSVPSISKILHATGEFSKDARKRVEDTELLLLEINDVYPHVQEELRANPNASPETIAKQRERRDIALQRMNELHSKYAIRNGDYLYTLSLFIVMPIKWINKYEWRKLDPIEEYAIFRMWYDTGLGMNIKDIPDTLEKMIAFHEEYGKEHVRYAESNWKVAHPTVELLLTRLPKFMAPLMKPLLNKALPSLLDPLDVVGFGLPEASPWMTSFIDTSLYLRALFIRHCMLPRFSSHTRTAINPDKKTNLYKTNYDIYKPVYPNGYCIHELGPEKSKPAKCPIPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.4
3 0.44
4 0.42
5 0.46
6 0.47
7 0.4
8 0.36
9 0.29
10 0.22
11 0.18
12 0.18
13 0.14
14 0.11
15 0.1
16 0.08
17 0.07
18 0.06
19 0.07
20 0.06
21 0.1
22 0.1
23 0.11
24 0.16
25 0.19
26 0.25
27 0.33
28 0.39
29 0.46
30 0.56
31 0.65
32 0.71
33 0.77
34 0.81
35 0.81
36 0.82
37 0.78
38 0.77
39 0.78
40 0.73
41 0.69
42 0.67
43 0.6
44 0.56
45 0.5
46 0.42
47 0.32
48 0.27
49 0.22
50 0.15
51 0.14
52 0.12
53 0.12
54 0.1
55 0.09
56 0.09
57 0.09
58 0.13
59 0.13
60 0.13
61 0.15
62 0.17
63 0.22
64 0.29
65 0.3
66 0.32
67 0.31
68 0.3
69 0.29
70 0.28
71 0.23
72 0.16
73 0.14
74 0.1
75 0.1
76 0.1
77 0.1
78 0.1
79 0.11
80 0.12
81 0.12
82 0.13
83 0.18
84 0.19
85 0.19
86 0.2
87 0.19
88 0.19
89 0.18
90 0.19
91 0.16
92 0.19
93 0.17
94 0.16
95 0.23
96 0.24
97 0.28
98 0.29
99 0.3
100 0.31
101 0.34
102 0.4
103 0.34
104 0.34
105 0.34
106 0.3
107 0.27
108 0.24
109 0.2
110 0.14
111 0.12
112 0.09
113 0.04
114 0.04
115 0.05
116 0.04
117 0.05
118 0.06
119 0.06
120 0.07
121 0.1
122 0.16
123 0.19
124 0.19
125 0.2
126 0.19
127 0.22
128 0.21
129 0.19
130 0.16
131 0.13
132 0.16
133 0.21
134 0.24
135 0.26
136 0.32
137 0.37
138 0.43
139 0.45
140 0.45
141 0.48
142 0.51
143 0.55
144 0.55
145 0.49
146 0.43
147 0.41
148 0.4
149 0.34
150 0.28
151 0.2
152 0.16
153 0.17
154 0.16
155 0.2
156 0.2
157 0.18
158 0.19
159 0.19
160 0.18
161 0.17
162 0.17
163 0.12
164 0.1
165 0.09
166 0.08
167 0.08
168 0.06
169 0.06
170 0.08
171 0.07
172 0.07
173 0.08
174 0.09
175 0.09
176 0.11
177 0.13
178 0.2
179 0.26
180 0.33
181 0.38
182 0.4
183 0.42
184 0.41
185 0.44
186 0.36
187 0.33
188 0.28
189 0.22
190 0.2
191 0.18
192 0.17
193 0.12
194 0.11
195 0.09
196 0.07
197 0.06
198 0.06
199 0.06
200 0.06
201 0.06
202 0.07
203 0.06
204 0.06
205 0.07
206 0.07
207 0.06
208 0.06
209 0.08
210 0.1
211 0.11
212 0.11
213 0.13
214 0.13
215 0.13
216 0.14
217 0.12
218 0.11
219 0.1
220 0.13
221 0.11
222 0.13
223 0.18
224 0.2
225 0.19
226 0.2
227 0.21
228 0.19
229 0.2
230 0.23
231 0.27
232 0.25
233 0.28
234 0.27
235 0.27
236 0.27
237 0.26
238 0.24
239 0.15
240 0.15
241 0.13
242 0.14
243 0.13
244 0.12
245 0.15
246 0.16
247 0.16
248 0.15
249 0.15
250 0.13
251 0.15
252 0.18
253 0.22
254 0.2
255 0.25
256 0.28
257 0.31
258 0.31
259 0.31
260 0.34
261 0.28
262 0.27
263 0.23
264 0.23
265 0.2
266 0.22
267 0.24
268 0.17
269 0.16
270 0.16
271 0.15
272 0.11
273 0.11
274 0.09
275 0.05
276 0.05
277 0.04
278 0.05
279 0.04
280 0.04
281 0.06
282 0.07
283 0.07
284 0.07
285 0.11
286 0.11
287 0.11
288 0.12
289 0.1
290 0.12
291 0.12
292 0.13
293 0.12
294 0.13
295 0.12
296 0.12
297 0.13
298 0.13
299 0.13
300 0.15
301 0.17
302 0.18
303 0.22
304 0.25
305 0.27
306 0.28
307 0.31
308 0.37
309 0.37
310 0.4
311 0.41
312 0.43
313 0.42
314 0.43
315 0.48
316 0.5
317 0.55
318 0.54
319 0.56
320 0.56
321 0.58
322 0.62
323 0.62
324 0.6
325 0.57
326 0.57
327 0.57
328 0.6
329 0.58
330 0.53
331 0.49
332 0.45
333 0.48
334 0.45
335 0.43
336 0.41
337 0.39
338 0.41
339 0.41
340 0.41
341 0.33
342 0.33
343 0.31
344 0.29
345 0.32
346 0.33
347 0.36
348 0.32
349 0.36
350 0.43
351 0.47
352 0.46
353 0.53