Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C406

Protein Details
Accession Q6C406    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-30AASNPHPKIVKKHRKAFKRHQSDRFDRVGBasic
NLS Segment(s)
PositionSequence
9-23KIVKKHRKAFKRHQS
Subcellular Location(s) mito 10.5, mito_nucl 10.5, nucl 9.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG yli:YALI0E30811g  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASNPHPKIVKKHRKAFKRHQSDRFDRVGESWRKPKGIDSCVRRRFRGTIRMPKIGYGSAKATKHMMPSGHKAFLVSNTEEVELLLMHTKVFAAEIAHNVSSRKRLAILERAKALGVKVTNPAGRLSLQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.88
4 0.89
5 0.89
6 0.89
7 0.88
8 0.88
9 0.89
10 0.87
11 0.83
12 0.77
13 0.67
14 0.57
15 0.49
16 0.49
17 0.46
18 0.45
19 0.45
20 0.44
21 0.44
22 0.43
23 0.47
24 0.46
25 0.47
26 0.48
27 0.5
28 0.57
29 0.65
30 0.68
31 0.63
32 0.59
33 0.57
34 0.55
35 0.57
36 0.55
37 0.57
38 0.58
39 0.63
40 0.59
41 0.54
42 0.49
43 0.41
44 0.32
45 0.24
46 0.22
47 0.21
48 0.21
49 0.21
50 0.21
51 0.2
52 0.2
53 0.21
54 0.19
55 0.17
56 0.23
57 0.26
58 0.25
59 0.24
60 0.23
61 0.21
62 0.22
63 0.22
64 0.16
65 0.14
66 0.14
67 0.14
68 0.14
69 0.13
70 0.1
71 0.06
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.06
81 0.06
82 0.07
83 0.09
84 0.12
85 0.13
86 0.14
87 0.14
88 0.16
89 0.18
90 0.19
91 0.18
92 0.17
93 0.2
94 0.25
95 0.34
96 0.4
97 0.41
98 0.42
99 0.42
100 0.4
101 0.37
102 0.32
103 0.28
104 0.22
105 0.18
106 0.2
107 0.25
108 0.26
109 0.26
110 0.27
111 0.24