Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A068RQW2

Protein Details
Accession A0A068RQW2    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
40-62LWAAPKKKTSHSKKRMRASNKGLHydrophilic
NLS Segment(s)
PositionSequence
44-57PKKKTSHSKKRMRA
Subcellular Location(s) mito 14, nucl 6, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MALARFAHQLALPSFTQSPAFGAIAVSSTFKLPIWLEPFLWAAPKKKTSHSKKRMRASNKGLQNKENVTACPACGNYKLLHHLCSHCYGNIKQQQKKMVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.2
4 0.16
5 0.16
6 0.14
7 0.14
8 0.11
9 0.1
10 0.09
11 0.09
12 0.09
13 0.09
14 0.07
15 0.07
16 0.08
17 0.07
18 0.1
19 0.09
20 0.13
21 0.16
22 0.17
23 0.17
24 0.18
25 0.19
26 0.17
27 0.19
28 0.17
29 0.17
30 0.2
31 0.25
32 0.26
33 0.32
34 0.42
35 0.49
36 0.59
37 0.66
38 0.72
39 0.75
40 0.82
41 0.84
42 0.81
43 0.8
44 0.77
45 0.75
46 0.73
47 0.73
48 0.67
49 0.6
50 0.57
51 0.49
52 0.46
53 0.39
54 0.3
55 0.26
56 0.24
57 0.22
58 0.2
59 0.19
60 0.16
61 0.17
62 0.18
63 0.16
64 0.18
65 0.26
66 0.25
67 0.27
68 0.29
69 0.3
70 0.31
71 0.35
72 0.34
73 0.28
74 0.32
75 0.32
76 0.38
77 0.44
78 0.5
79 0.52
80 0.56