Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A068RPT2

Protein Details
Accession A0A068RPT2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-84NTPVIVKKRRTHKSQEQQEEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, extr 5, plas 4, E.R. 3, cyto 1, pero 1, golg 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR031459  Coa2  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF17051  COA2  
Amino Acid Sequences MFGSKARPLNHLQRQRITSNLFVMVALGAVATVAAPTVFPCPAFDQNDKAARLEARRKLKAQQGNTPVIVKKRRTHKSQEQQEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.64
3 0.62
4 0.55
5 0.48
6 0.4
7 0.35
8 0.27
9 0.22
10 0.2
11 0.14
12 0.1
13 0.07
14 0.04
15 0.03
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.03
24 0.04
25 0.05
26 0.05
27 0.06
28 0.1
29 0.13
30 0.17
31 0.18
32 0.2
33 0.25
34 0.3
35 0.29
36 0.27
37 0.25
38 0.23
39 0.27
40 0.32
41 0.35
42 0.39
43 0.43
44 0.45
45 0.49
46 0.55
47 0.58
48 0.56
49 0.57
50 0.55
51 0.55
52 0.55
53 0.53
54 0.47
55 0.47
56 0.49
57 0.46
58 0.47
59 0.53
60 0.6
61 0.64
62 0.71
63 0.75
64 0.78