Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C018

Protein Details
Accession Q6C018    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
203-223PSPPPVPGRRRPRAPTREQILHydrophilic
NLS Segment(s)
PositionSequence
212-213RR
Subcellular Location(s) cyto 12, cyto_nucl 10, mito 8, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013536  WLM_dom  
Gene Ontology GO:0000324  C:fungal-type vacuole  
GO:0005635  C:nuclear envelope  
GO:0005634  C:nucleus  
GO:0004222  F:metalloendopeptidase activity  
GO:0008237  F:metallopeptidase activity  
GO:0032183  F:SUMO binding  
GO:0061665  F:SUMO ligase activity  
GO:0006281  P:DNA repair  
GO:0036205  P:histone catabolic process  
GO:1990466  P:protein autosumoylation  
GO:0106300  P:protein-DNA covalent cross-linking repair  
GO:1990414  P:replication-born double-strand break repair via sister chromatid exchange  
GO:0019985  P:translesion synthesis  
KEGG yli:YALI0F28523g  -  
Pfam View protein in Pfam  
PF08325  WLM  
PROSITE View protein in PROSITE  
PS51397  WLM  
Amino Acid Sequences MEFISNITVLKKRPGSEAALEMITRAARFVQPIMKNHGFKVGTLCEMFPKHANLLGLNVNHGQKVCLRLRQHYDDKMFLPFESIMGTLLHELCHNKYGPHNAQFYAYLKELEDDYYALKARGFNPDTPYGFLGPGKTLGSGGGRKLNGPASGIAGIPGLGAGPGGRALPKTNVTLSPSKVVKPKTGRQKRFTGTGNVLGSSTPSPPPVPGRRRPRAPTREQILAAVEKRIADTKWCASENVEISKEVDENDDDVVFLGAKNASEIEVIDLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.4
4 0.42
5 0.36
6 0.33
7 0.31
8 0.26
9 0.23
10 0.19
11 0.15
12 0.12
13 0.11
14 0.11
15 0.13
16 0.16
17 0.23
18 0.27
19 0.31
20 0.4
21 0.46
22 0.46
23 0.45
24 0.51
25 0.42
26 0.37
27 0.4
28 0.33
29 0.28
30 0.28
31 0.27
32 0.24
33 0.25
34 0.26
35 0.23
36 0.23
37 0.21
38 0.23
39 0.23
40 0.19
41 0.2
42 0.22
43 0.2
44 0.19
45 0.22
46 0.2
47 0.2
48 0.19
49 0.17
50 0.15
51 0.22
52 0.24
53 0.28
54 0.3
55 0.36
56 0.43
57 0.51
58 0.55
59 0.55
60 0.55
61 0.51
62 0.49
63 0.46
64 0.39
65 0.3
66 0.26
67 0.19
68 0.15
69 0.13
70 0.12
71 0.09
72 0.09
73 0.09
74 0.07
75 0.08
76 0.08
77 0.08
78 0.1
79 0.1
80 0.13
81 0.13
82 0.13
83 0.16
84 0.24
85 0.29
86 0.33
87 0.34
88 0.31
89 0.32
90 0.33
91 0.32
92 0.26
93 0.21
94 0.16
95 0.14
96 0.14
97 0.13
98 0.12
99 0.1
100 0.08
101 0.07
102 0.08
103 0.09
104 0.08
105 0.09
106 0.1
107 0.1
108 0.18
109 0.2
110 0.21
111 0.24
112 0.29
113 0.29
114 0.28
115 0.28
116 0.21
117 0.19
118 0.17
119 0.13
120 0.09
121 0.1
122 0.08
123 0.08
124 0.07
125 0.07
126 0.09
127 0.09
128 0.1
129 0.13
130 0.13
131 0.13
132 0.14
133 0.16
134 0.14
135 0.14
136 0.13
137 0.1
138 0.11
139 0.11
140 0.09
141 0.07
142 0.07
143 0.05
144 0.05
145 0.03
146 0.02
147 0.02
148 0.02
149 0.02
150 0.03
151 0.03
152 0.04
153 0.04
154 0.06
155 0.09
156 0.11
157 0.13
158 0.14
159 0.16
160 0.2
161 0.23
162 0.23
163 0.27
164 0.26
165 0.27
166 0.31
167 0.32
168 0.36
169 0.39
170 0.45
171 0.51
172 0.6
173 0.66
174 0.67
175 0.74
176 0.69
177 0.68
178 0.64
179 0.6
180 0.53
181 0.51
182 0.46
183 0.37
184 0.34
185 0.27
186 0.25
187 0.19
188 0.17
189 0.11
190 0.12
191 0.12
192 0.14
193 0.22
194 0.31
195 0.38
196 0.46
197 0.55
198 0.63
199 0.71
200 0.77
201 0.8
202 0.8
203 0.8
204 0.8
205 0.75
206 0.73
207 0.65
208 0.59
209 0.51
210 0.47
211 0.39
212 0.31
213 0.26
214 0.2
215 0.2
216 0.22
217 0.19
218 0.17
219 0.21
220 0.25
221 0.3
222 0.31
223 0.3
224 0.3
225 0.36
226 0.36
227 0.37
228 0.33
229 0.28
230 0.28
231 0.29
232 0.27
233 0.21
234 0.19
235 0.14
236 0.14
237 0.15
238 0.13
239 0.12
240 0.11
241 0.11
242 0.09
243 0.08
244 0.09
245 0.08
246 0.08
247 0.09
248 0.09
249 0.09
250 0.09
251 0.1