Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CC12

Protein Details
Accession Q6CC12    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
197-222EEMKLAEIKRREKREKKDFYRFQIREBasic
NLS Segment(s)
PositionSequence
205-213KRREKREKK
Subcellular Location(s) cyto 12, nucl 8.5, mito_nucl 7, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR040447  RRM_Rrp7  
IPR040446  RRP7  
IPR024326  RRP7_C  
Gene Ontology GO:0032545  C:CURI complex  
GO:0034456  C:UTP-C complex  
GO:0003676  F:nucleic acid binding  
GO:0000028  P:ribosomal small subunit assembly  
GO:0006364  P:rRNA processing  
KEGG yli:YALI0C13596g  -  
Pfam View protein in Pfam  
PF17799  RRM_Rrp7  
PF12923  RRP7  
CDD cd12950  RRP7_Rrp7p  
Amino Acid Sequences MSGYETLPLKMPKGNTHYLYMKKDDNSAASEDSTIFVCNLPADSTLSHIKALCQSLGGSIVESFEWVNVSRNVRAESLTHGLSGGCGRIHMVDAASCNRVLSQAKKNATCGVKWDAKLTIGGKQRYQLLWKYCFPAPDDLQAEVDYFMEEFAAREEEEKKVEKTGRTVVDADGFTTVVKTQKKKSLAMQEAAKQQAEEMKLAEIKRREKREKKDFYRFQIREYKKEQMTDMLTKFKEDQEKVKQYKESGRFNPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.41
3 0.46
4 0.52
5 0.55
6 0.57
7 0.54
8 0.53
9 0.46
10 0.48
11 0.44
12 0.39
13 0.35
14 0.32
15 0.29
16 0.24
17 0.23
18 0.19
19 0.17
20 0.15
21 0.13
22 0.1
23 0.09
24 0.09
25 0.08
26 0.09
27 0.09
28 0.09
29 0.1
30 0.1
31 0.14
32 0.17
33 0.18
34 0.18
35 0.17
36 0.18
37 0.21
38 0.23
39 0.19
40 0.16
41 0.15
42 0.14
43 0.16
44 0.15
45 0.1
46 0.09
47 0.09
48 0.08
49 0.08
50 0.08
51 0.06
52 0.07
53 0.07
54 0.1
55 0.13
56 0.16
57 0.18
58 0.2
59 0.22
60 0.21
61 0.22
62 0.2
63 0.2
64 0.21
65 0.19
66 0.16
67 0.15
68 0.14
69 0.13
70 0.13
71 0.09
72 0.06
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.06
79 0.06
80 0.08
81 0.1
82 0.11
83 0.1
84 0.1
85 0.09
86 0.12
87 0.13
88 0.17
89 0.23
90 0.29
91 0.34
92 0.35
93 0.36
94 0.4
95 0.39
96 0.33
97 0.3
98 0.28
99 0.28
100 0.27
101 0.28
102 0.22
103 0.21
104 0.23
105 0.2
106 0.21
107 0.23
108 0.24
109 0.23
110 0.24
111 0.26
112 0.24
113 0.26
114 0.25
115 0.24
116 0.27
117 0.28
118 0.29
119 0.28
120 0.29
121 0.27
122 0.28
123 0.24
124 0.25
125 0.25
126 0.22
127 0.22
128 0.2
129 0.19
130 0.14
131 0.13
132 0.07
133 0.06
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.05
140 0.05
141 0.07
142 0.08
143 0.1
144 0.13
145 0.15
146 0.15
147 0.19
148 0.23
149 0.23
150 0.25
151 0.3
152 0.3
153 0.3
154 0.3
155 0.26
156 0.26
157 0.25
158 0.22
159 0.16
160 0.13
161 0.11
162 0.1
163 0.1
164 0.12
165 0.17
166 0.2
167 0.25
168 0.33
169 0.37
170 0.4
171 0.47
172 0.52
173 0.53
174 0.54
175 0.54
176 0.52
177 0.53
178 0.52
179 0.45
180 0.34
181 0.29
182 0.28
183 0.24
184 0.19
185 0.14
186 0.14
187 0.18
188 0.19
189 0.24
190 0.27
191 0.34
192 0.43
193 0.52
194 0.61
195 0.67
196 0.77
197 0.82
198 0.87
199 0.87
200 0.9
201 0.88
202 0.87
203 0.89
204 0.79
205 0.75
206 0.74
207 0.7
208 0.67
209 0.64
210 0.64
211 0.57
212 0.59
213 0.54
214 0.5
215 0.5
216 0.5
217 0.47
218 0.45
219 0.42
220 0.41
221 0.42
222 0.41
223 0.44
224 0.4
225 0.45
226 0.48
227 0.59
228 0.61
229 0.66
230 0.64
231 0.61
232 0.68
233 0.67
234 0.67