FuNGI

A0A068RIZ2

Protein Details

Accession

A0A068RIZ2

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
70-90	QMKSRGTSKKVQKFYREQNDL	Hydrophilic
411-435	VTPVVKHKIIKKRTAPFKRHQSDRF	Hydrophilic

NLS Segment(s)

Position	Sequence
417-464	HKIIKKRTAPFKRHQSDRFARVGESWRKPKGIDNAMRRRFKGQAAMPK

Subcellular Location(s)

plas 20, mito 3, E.R. 3

Family & Domain DBs

InterPro	View protein in InterPro IPR002524 Cation_efflux IPR027470 Cation_efflux_CTD IPR036837 Cation_efflux_CTD_sf IPR027469 Cation_efflux_TMD_sf IPR001515 Ribosomal_L32e IPR018263 Ribosomal_L32e_CS IPR036351 Ribosomal_L32e_sf
Gene Ontology	GO:0016020 C:membrane GO:1990904 C:ribonucleoprotein complex GO:0005840 C:ribosome GO:0008324 F:monoatomic cation transmembrane transporter activity GO:0003735 F:structural constituent of ribosome GO:0098771 P:inorganic ion homeostasis GO:0030003 P:intracellular monoatomic cation homeostasis GO:0006412 P:translation
Pfam	View protein in Pfam PF01545 Cation_efflux PF01655 Ribosomal_L32e PF16916 ZT_dimer
PROSITE	View protein in PROSITE PS00580 RIBOSOMAL_L32E
CDD	cd00513 Ribosomal_L32_L32e

Amino Acid Sequences

MTTTSTQTIELSPITTRQSSIAPLNPGYSLQHRHPPGRDVADASLEHGFDRPTDPLSLYNSKKTEEDLKQMKSRGTSKKVQKFYREQNDLIDNMLSPLNPIDEEDEQRQMLKVKIAVYGSGMANVVLFALQLVAAISSGSLSIFATMADSFMDLLSSIVLMWAARQVSRPNPIKYPAGKERMETAAIMVFSCLMSCVAIFLIIESAQKLAEGDVESPDLSTLSIALVATALGVKFLLFIYCSTLSQYSSAKVFAQDHRNDILVNGLGLTTGILGSRLAGWVDPTGSIIIALIILRSWTSTLIDHTKLIVGKTADNEFLKRATYIALTHPGVHQVDTCRAYYAGNNLFVEVDIVLPPDTMLRESHDIGESLQIKLESIPTVARAFVHVDYETLILASFITPSPSSIHQGTMVTPVVKHKIIKKRTAPFKRHQSDRFARVGESWRKPKGIDNAMRRRFKGQAAMPKIGYGSAKKTRHMLPNGFRKFTVSNVKQLDLLLMHNRSYAAEIAHNVCAKKRVEIIERAAQLNVKVINAGARLRSQE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.21
2	0.21
3	0.21
4	0.2
5	0.21
6	0.24
7	0.28
8	0.31
9	0.31
10	0.31
11	0.32
12	0.31
13	0.3
14	0.29
15	0.3
16	0.3
17	0.3
18	0.38
19	0.42
20	0.48
21	0.51
22	0.52
23	0.54
24	0.53
25	0.51
26	0.45
27	0.42
28	0.4
29	0.36
30	0.33
31	0.27
32	0.22
33	0.2
34	0.17
35	0.16
36	0.12
37	0.15
38	0.14
39	0.14
40	0.16
41	0.17
42	0.19
43	0.25
44	0.33
45	0.34
46	0.4
47	0.4
48	0.4
49	0.39
50	0.4
51	0.43
52	0.4
53	0.46
54	0.46
55	0.51
56	0.56
57	0.58
58	0.57
59	0.54
60	0.57
61	0.57
62	0.56
63	0.59
64	0.64
65	0.7
66	0.77
67	0.78
68	0.79
69	0.79
70	0.83
71	0.84
72	0.79
73	0.7
74	0.66
75	0.63
76	0.54
77	0.45
78	0.35
79	0.24
80	0.19
81	0.19
82	0.13
83	0.09
84	0.1
85	0.09
86	0.08
87	0.09
88	0.11
89	0.14
90	0.18
91	0.2
92	0.22
93	0.22
94	0.22
95	0.23
96	0.22
97	0.21
98	0.2
99	0.2
100	0.19
101	0.22
102	0.22
103	0.21
104	0.19
105	0.2
106	0.17
107	0.16
108	0.14
109	0.1
110	0.1
111	0.09
112	0.08
113	0.04
114	0.04
115	0.03
116	0.03
117	0.03
118	0.03
119	0.03
120	0.03
121	0.03
122	0.03
123	0.03
124	0.03
125	0.03
126	0.03
127	0.03
128	0.03
129	0.04
130	0.04
131	0.04
132	0.05
133	0.05
134	0.05
135	0.05
136	0.05
137	0.05
138	0.05
139	0.05
140	0.04
141	0.04
142	0.04
143	0.04
144	0.03
145	0.03
146	0.03
147	0.03
148	0.03
149	0.06
150	0.06
151	0.07
152	0.09
153	0.13
154	0.17
155	0.26
156	0.33
157	0.33
158	0.36
159	0.4
160	0.44
161	0.45
162	0.49
163	0.48
164	0.49
165	0.46
166	0.44
167	0.44
168	0.4
169	0.36
170	0.28
171	0.2
172	0.15
173	0.15
174	0.14
175	0.1
176	0.07
177	0.06
178	0.06
179	0.06
180	0.04
181	0.04
182	0.03
183	0.04
184	0.04
185	0.04
186	0.04
187	0.04
188	0.04
189	0.04
190	0.05
191	0.05
192	0.05
193	0.05
194	0.05
195	0.05
196	0.04
197	0.06
198	0.06
199	0.07
200	0.07
201	0.08
202	0.08
203	0.08
204	0.08
205	0.06
206	0.05
207	0.05
208	0.04
209	0.03
210	0.04
211	0.04
212	0.03
213	0.03
214	0.03
215	0.03
216	0.04
217	0.03
218	0.03
219	0.03
220	0.03
221	0.03
222	0.04
223	0.04
224	0.04
225	0.04
226	0.08
227	0.09
228	0.09
229	0.1
230	0.11
231	0.11
232	0.13
233	0.13
234	0.1
235	0.1
236	0.11
237	0.1
238	0.11
239	0.14
240	0.17
241	0.25
242	0.25
243	0.27
244	0.27
245	0.27
246	0.25
247	0.22
248	0.18
249	0.1
250	0.08
251	0.06
252	0.05
253	0.04
254	0.04
255	0.04
256	0.02
257	0.02
258	0.02
259	0.03
260	0.03
261	0.03
262	0.03
263	0.04
264	0.04
265	0.03
266	0.04
267	0.04
268	0.05
269	0.05
270	0.05
271	0.05
272	0.05
273	0.05
274	0.04
275	0.03
276	0.03
277	0.03
278	0.03
279	0.02
280	0.03
281	0.03
282	0.03
283	0.03
284	0.04
285	0.05
286	0.05
287	0.08
288	0.12
289	0.13
290	0.13
291	0.13
292	0.15
293	0.15
294	0.14
295	0.15
296	0.12
297	0.12
298	0.14
299	0.15
300	0.16
301	0.16
302	0.17
303	0.15
304	0.14
305	0.14
306	0.12
307	0.11
308	0.09
309	0.09
310	0.1
311	0.11
312	0.15
313	0.15
314	0.16
315	0.16
316	0.19
317	0.18
318	0.17
319	0.16
320	0.13
321	0.18
322	0.19
323	0.19
324	0.17
325	0.17
326	0.17
327	0.16
328	0.21
329	0.19
330	0.2
331	0.2
332	0.19
333	0.19
334	0.18
335	0.17
336	0.11
337	0.08
338	0.05
339	0.06
340	0.05
341	0.05
342	0.05
343	0.06
344	0.06
345	0.06
346	0.07
347	0.1
348	0.13
349	0.14
350	0.15
351	0.15
352	0.15
353	0.15
354	0.2
355	0.18
356	0.15
357	0.15
358	0.13
359	0.13
360	0.13
361	0.14
362	0.09
363	0.08
364	0.09
365	0.09
366	0.1
367	0.1
368	0.1
369	0.1
370	0.12
371	0.12
372	0.14
373	0.12
374	0.11
375	0.12
376	0.12
377	0.11
378	0.08
379	0.07
380	0.05
381	0.05
382	0.05
383	0.05
384	0.05
385	0.07
386	0.07
387	0.08
388	0.11
389	0.13
390	0.17
391	0.16
392	0.18
393	0.17
394	0.18
395	0.18
396	0.19
397	0.19
398	0.16
399	0.15
400	0.18
401	0.2
402	0.22
403	0.25
404	0.29
405	0.38
406	0.45
407	0.54
408	0.59
409	0.65
410	0.74
411	0.81
412	0.81
413	0.81
414	0.85
415	0.84
416	0.84
417	0.79
418	0.79
419	0.77
420	0.75
421	0.71
422	0.61
423	0.53
424	0.48
425	0.52
426	0.51
427	0.51
428	0.52
429	0.51
430	0.51
431	0.51
432	0.54
433	0.55
434	0.55
435	0.55
436	0.59
437	0.66
438	0.73
439	0.78
440	0.73
441	0.67
442	0.61
443	0.56
444	0.54
445	0.51
446	0.53
447	0.54
448	0.57
449	0.53
450	0.49
451	0.46
452	0.38
453	0.33
454	0.26
455	0.27
456	0.32
457	0.35
458	0.36
459	0.41
460	0.47
461	0.53
462	0.59
463	0.6
464	0.6
465	0.68
466	0.73
467	0.7
468	0.63
469	0.58
470	0.51
471	0.48
472	0.5
473	0.42
474	0.44
475	0.45
476	0.46
477	0.43
478	0.41
479	0.37
480	0.27
481	0.27
482	0.25
483	0.24
484	0.23
485	0.23
486	0.23
487	0.21
488	0.22
489	0.2
490	0.14
491	0.15
492	0.18
493	0.21
494	0.25
495	0.28
496	0.26
497	0.27
498	0.32
499	0.31
500	0.31
501	0.35
502	0.37
503	0.41
504	0.48
505	0.53
506	0.54
507	0.56
508	0.54
509	0.49
510	0.43
511	0.36
512	0.34
513	0.28
514	0.2
515	0.17
516	0.16
517	0.18
518	0.19
519	0.21
520	0.19

A0A068RIZ2

3D AlphaFold-predicted Structure Viewer