Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068RIZ2

Protein Details
Accession A0A068RIZ2   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
70-90QMKSRGTSKKVQKFYREQNDLHydrophilic
411-435VTPVVKHKIIKKRTAPFKRHQSDRFHydrophilic
NLS Segment(s)
PositionSequence
417-464HKIIKKRTAPFKRHQSDRFARVGESWRKPKGIDNAMRRRFKGQAAMPK
Subcellular Location(s) plas 20, mito 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002524  Cation_efflux  
IPR027470  Cation_efflux_CTD  
IPR036837  Cation_efflux_CTD_sf  
IPR027469  Cation_efflux_TMD_sf  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0016020  C:membrane  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0008324  F:monoatomic cation transmembrane transporter activity  
GO:0003735  F:structural constituent of ribosome  
GO:0098771  P:inorganic ion homeostasis  
GO:0030003  P:intracellular monoatomic cation homeostasis  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01545  Cation_efflux  
PF01655  Ribosomal_L32e  
PF16916  ZT_dimer  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MTTTSTQTIELSPITTRQSSIAPLNPGYSLQHRHPPGRDVADASLEHGFDRPTDPLSLYNSKKTEEDLKQMKSRGTSKKVQKFYREQNDLIDNMLSPLNPIDEEDEQRQMLKVKIAVYGSGMANVVLFALQLVAAISSGSLSIFATMADSFMDLLSSIVLMWAARQVSRPNPIKYPAGKERMETAAIMVFSCLMSCVAIFLIIESAQKLAEGDVESPDLSTLSIALVATALGVKFLLFIYCSTLSQYSSAKVFAQDHRNDILVNGLGLTTGILGSRLAGWVDPTGSIIIALIILRSWTSTLIDHTKLIVGKTADNEFLKRATYIALTHPGVHQVDTCRAYYAGNNLFVEVDIVLPPDTMLRESHDIGESLQIKLESIPTVARAFVHVDYETLILASFITPSPSSIHQGTMVTPVVKHKIIKKRTAPFKRHQSDRFARVGESWRKPKGIDNAMRRRFKGQAAMPKIGYGSAKKTRHMLPNGFRKFTVSNVKQLDLLLMHNRSYAAEIAHNVCAKKRVEIIERAAQLNVKVINAGARLRSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.21
4 0.2
5 0.21
6 0.24
7 0.28
8 0.31
9 0.31
10 0.31
11 0.32
12 0.31
13 0.3
14 0.29
15 0.3
16 0.3
17 0.3
18 0.38
19 0.42
20 0.48
21 0.51
22 0.52
23 0.54
24 0.53
25 0.51
26 0.45
27 0.42
28 0.4
29 0.36
30 0.33
31 0.27
32 0.22
33 0.2
34 0.17
35 0.16
36 0.12
37 0.15
38 0.14
39 0.14
40 0.16
41 0.17
42 0.19
43 0.25
44 0.33
45 0.34
46 0.4
47 0.4
48 0.4
49 0.39
50 0.4
51 0.43
52 0.4
53 0.46
54 0.46
55 0.51
56 0.56
57 0.58
58 0.57
59 0.54
60 0.57
61 0.57
62 0.56
63 0.59
64 0.64
65 0.7
66 0.77
67 0.78
68 0.79
69 0.79
70 0.83
71 0.84
72 0.79
73 0.7
74 0.66
75 0.63
76 0.54
77 0.45
78 0.35
79 0.24
80 0.19
81 0.19
82 0.13
83 0.09
84 0.1
85 0.09
86 0.08
87 0.09
88 0.11
89 0.14
90 0.18
91 0.2
92 0.22
93 0.22
94 0.22
95 0.23
96 0.22
97 0.21
98 0.2
99 0.2
100 0.19
101 0.22
102 0.22
103 0.21
104 0.19
105 0.2
106 0.17
107 0.16
108 0.14
109 0.1
110 0.1
111 0.09
112 0.08
113 0.04
114 0.04
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.04
130 0.04
131 0.04
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.04
141 0.04
142 0.04
143 0.04
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.06
150 0.06
151 0.07
152 0.09
153 0.13
154 0.17
155 0.26
156 0.33
157 0.33
158 0.36
159 0.4
160 0.44
161 0.45
162 0.49
163 0.48
164 0.49
165 0.46
166 0.44
167 0.44
168 0.4
169 0.36
170 0.28
171 0.2
172 0.15
173 0.15
174 0.14
175 0.1
176 0.07
177 0.06
178 0.06
179 0.06
180 0.04
181 0.04
182 0.03
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.04
197 0.06
198 0.06
199 0.07
200 0.07
201 0.08
202 0.08
203 0.08
204 0.08
205 0.06
206 0.05
207 0.05
208 0.04
209 0.03
210 0.04
211 0.04
212 0.03
213 0.03
214 0.03
215 0.03
216 0.04
217 0.03
218 0.03
219 0.03
220 0.03
221 0.03
222 0.04
223 0.04
224 0.04
225 0.04
226 0.08
227 0.09
228 0.09
229 0.1
230 0.11
231 0.11
232 0.13
233 0.13
234 0.1
235 0.1
236 0.11
237 0.1
238 0.11
239 0.14
240 0.17
241 0.25
242 0.25
243 0.27
244 0.27
245 0.27
246 0.25
247 0.22
248 0.18
249 0.1
250 0.08
251 0.06
252 0.05
253 0.04
254 0.04
255 0.04
256 0.02
257 0.02
258 0.02
259 0.03
260 0.03
261 0.03
262 0.03
263 0.04
264 0.04
265 0.03
266 0.04
267 0.04
268 0.05
269 0.05
270 0.05
271 0.05
272 0.05
273 0.05
274 0.04
275 0.03
276 0.03
277 0.03
278 0.03
279 0.02
280 0.03
281 0.03
282 0.03
283 0.03
284 0.04
285 0.05
286 0.05
287 0.08
288 0.12
289 0.13
290 0.13
291 0.13
292 0.15
293 0.15
294 0.14
295 0.15
296 0.12
297 0.12
298 0.14
299 0.15
300 0.16
301 0.16
302 0.17
303 0.15
304 0.14
305 0.14
306 0.12
307 0.11
308 0.09
309 0.09
310 0.1
311 0.11
312 0.15
313 0.15
314 0.16
315 0.16
316 0.19
317 0.18
318 0.17
319 0.16
320 0.13
321 0.18
322 0.19
323 0.19
324 0.17
325 0.17
326 0.17
327 0.16
328 0.21
329 0.19
330 0.2
331 0.2
332 0.19
333 0.19
334 0.18
335 0.17
336 0.11
337 0.08
338 0.05
339 0.06
340 0.05
341 0.05
342 0.05
343 0.06
344 0.06
345 0.06
346 0.07
347 0.1
348 0.13
349 0.14
350 0.15
351 0.15
352 0.15
353 0.15
354 0.2
355 0.18
356 0.15
357 0.15
358 0.13
359 0.13
360 0.13
361 0.14
362 0.09
363 0.08
364 0.09
365 0.09
366 0.1
367 0.1
368 0.1
369 0.1
370 0.12
371 0.12
372 0.14
373 0.12
374 0.11
375 0.12
376 0.12
377 0.11
378 0.08
379 0.07
380 0.05
381 0.05
382 0.05
383 0.05
384 0.05
385 0.07
386 0.07
387 0.08
388 0.11
389 0.13
390 0.17
391 0.16
392 0.18
393 0.17
394 0.18
395 0.18
396 0.19
397 0.19
398 0.16
399 0.15
400 0.18
401 0.2
402 0.22
403 0.25
404 0.29
405 0.38
406 0.45
407 0.54
408 0.59
409 0.65
410 0.74
411 0.81
412 0.81
413 0.81
414 0.85
415 0.84
416 0.84
417 0.79
418 0.79
419 0.77
420 0.75
421 0.71
422 0.61
423 0.53
424 0.48
425 0.52
426 0.51
427 0.51
428 0.52
429 0.51
430 0.51
431 0.51
432 0.54
433 0.55
434 0.55
435 0.55
436 0.59
437 0.66
438 0.73
439 0.78
440 0.73
441 0.67
442 0.61
443 0.56
444 0.54
445 0.51
446 0.53
447 0.54
448 0.57
449 0.53
450 0.49
451 0.46
452 0.38
453 0.33
454 0.26
455 0.27
456 0.32
457 0.35
458 0.36
459 0.41
460 0.47
461 0.53
462 0.59
463 0.6
464 0.6
465 0.68
466 0.73
467 0.7
468 0.63
469 0.58
470 0.51
471 0.48
472 0.5
473 0.42
474 0.44
475 0.45
476 0.46
477 0.43
478 0.41
479 0.37
480 0.27
481 0.27
482 0.25
483 0.24
484 0.23
485 0.23
486 0.23
487 0.21
488 0.22
489 0.2
490 0.14
491 0.15
492 0.18
493 0.21
494 0.25
495 0.28
496 0.26
497 0.27
498 0.32
499 0.31
500 0.31
501 0.35
502 0.37
503 0.41
504 0.48
505 0.53
506 0.54
507 0.56
508 0.54
509 0.49
510 0.43
511 0.36
512 0.34
513 0.28
514 0.2
515 0.17
516 0.16
517 0.18
518 0.19
519 0.21
520 0.19