Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068S1I6

Protein Details
Accession A0A068S1I6    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-39FCQTCPYTYKIKQRHTTRKELQRKEVDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 10, pero 2, plas 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR012164  Rpa12/Rpb9/Rpc10/TFS  
IPR034014  Zn_ribbon_RPC11_C  
IPR001222  Znf_TFIIS  
Gene Ontology GO:0005730  C:nucleolus  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
GO:0042779  P:tRNA 3'-trailer cleavage  
Pfam View protein in Pfam  
PF01096  TFIIS_C  
PROSITE View protein in PROSITE  
PS00466  ZF_TFIIS_1  
PS51133  ZF_TFIIS_2  
CDD cd10509  Zn-ribbon_RPC11  
Amino Acid Sequences MLLIENEDGQDFFCQTCPYTYKIKQRHTTRKELQRKEVDDVLGGADAWKNVDSTEITCPKCEHERAFFMQIQIRSADEPMSIFYKCCNDACQHQWREG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.16
4 0.17
5 0.19
6 0.27
7 0.34
8 0.42
9 0.51
10 0.59
11 0.65
12 0.73
13 0.81
14 0.79
15 0.83
16 0.82
17 0.84
18 0.85
19 0.82
20 0.8
21 0.77
22 0.74
23 0.68
24 0.61
25 0.5
26 0.4
27 0.33
28 0.24
29 0.15
30 0.12
31 0.08
32 0.05
33 0.05
34 0.05
35 0.05
36 0.04
37 0.04
38 0.06
39 0.06
40 0.07
41 0.13
42 0.19
43 0.19
44 0.2
45 0.21
46 0.23
47 0.28
48 0.3
49 0.27
50 0.26
51 0.3
52 0.33
53 0.38
54 0.36
55 0.33
56 0.35
57 0.32
58 0.28
59 0.24
60 0.21
61 0.17
62 0.16
63 0.15
64 0.1
65 0.1
66 0.11
67 0.12
68 0.12
69 0.11
70 0.13
71 0.17
72 0.19
73 0.2
74 0.21
75 0.23
76 0.31
77 0.39
78 0.47