Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068SH56

Protein Details
Accession A0A068SH56   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
170-194IGNAIFTKKKHGKRQHIGGRRSSNWHydrophilic
NLS Segment(s)
PositionSequence
177-186KKKHGKRQHI
Subcellular Location(s) nucl 11, mito_nucl 8.833, cyto_nucl 8.333, mito 5.5, cyto 4.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011010  DNA_brk_join_enz  
IPR013762  Integrase-like_cat_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0015074  P:DNA integration  
GO:0006310  P:DNA recombination  
Amino Acid Sequences MWRIRSDIGRLQWKDVILHKEGTDNYTGVSLVVRMPKEGQVKMSKLGPIEDDLVCPVLTTAYYMEKTRDMRHDLAEDHTFFLGYIERASWVRSIHPATASSWLSQIMKEAGIDTTKYPPHSIRAASATKAVLQGIDIQDVKLHANWSLRTDTFERYYLRPSRQHQRGSYIGNAIFTKKKHGKRQHIGGRRSSNWDWRSVNASRSTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.41
4 0.34
5 0.35
6 0.31
7 0.34
8 0.33
9 0.32
10 0.27
11 0.22
12 0.19
13 0.17
14 0.16
15 0.11
16 0.11
17 0.09
18 0.09
19 0.14
20 0.14
21 0.15
22 0.16
23 0.22
24 0.27
25 0.28
26 0.31
27 0.33
28 0.35
29 0.36
30 0.38
31 0.33
32 0.29
33 0.29
34 0.24
35 0.19
36 0.2
37 0.18
38 0.15
39 0.14
40 0.14
41 0.13
42 0.11
43 0.09
44 0.06
45 0.06
46 0.06
47 0.07
48 0.09
49 0.1
50 0.11
51 0.13
52 0.17
53 0.19
54 0.23
55 0.27
56 0.29
57 0.29
58 0.31
59 0.32
60 0.29
61 0.3
62 0.29
63 0.25
64 0.21
65 0.19
66 0.16
67 0.14
68 0.13
69 0.1
70 0.07
71 0.06
72 0.05
73 0.07
74 0.07
75 0.08
76 0.09
77 0.09
78 0.09
79 0.13
80 0.14
81 0.14
82 0.15
83 0.15
84 0.15
85 0.19
86 0.18
87 0.15
88 0.14
89 0.14
90 0.13
91 0.12
92 0.12
93 0.08
94 0.07
95 0.07
96 0.07
97 0.06
98 0.07
99 0.07
100 0.07
101 0.1
102 0.12
103 0.13
104 0.14
105 0.15
106 0.17
107 0.2
108 0.2
109 0.18
110 0.22
111 0.23
112 0.22
113 0.23
114 0.2
115 0.17
116 0.17
117 0.15
118 0.1
119 0.08
120 0.11
121 0.1
122 0.12
123 0.11
124 0.11
125 0.12
126 0.12
127 0.13
128 0.1
129 0.1
130 0.1
131 0.14
132 0.15
133 0.17
134 0.2
135 0.2
136 0.22
137 0.24
138 0.25
139 0.25
140 0.28
141 0.28
142 0.26
143 0.34
144 0.36
145 0.4
146 0.44
147 0.48
148 0.54
149 0.6
150 0.66
151 0.61
152 0.62
153 0.61
154 0.58
155 0.55
156 0.49
157 0.42
158 0.37
159 0.35
160 0.31
161 0.3
162 0.26
163 0.33
164 0.37
165 0.45
166 0.53
167 0.63
168 0.71
169 0.77
170 0.87
171 0.88
172 0.89
173 0.86
174 0.85
175 0.83
176 0.76
177 0.74
178 0.68
179 0.67
180 0.59
181 0.6
182 0.53
183 0.47
184 0.5
185 0.45
186 0.47