Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C5A4

Protein Details
Accession Q6C5A4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MVKKRASNGRNKKGRGHVTSHydrophilic
84-110VRVRSREGRKVRTPPQRVRFNKDGKKIBasic
NLS Segment(s)
PositionSequence
5-14RASNGRNKKG
87-109RSREGRKVRTPPQRVRFNKDGKK
Subcellular Location(s) mito 16.5, mito_nucl 11.833, nucl 6, cyto_nucl 5.833, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003729  F:mRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG yli:YALI0E19701g  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRASNGRNKKGRGHVTSIRCSNCARMVPKDKAIKRFTIRNMVEAASIRDLSEASVYQEYVLPKLYLKIQYCVSCAIHSKVVRVRSREGRKVRTPPQRVRFNKDGKKINPAAAAKVVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.75
3 0.72
4 0.7
5 0.68
6 0.72
7 0.71
8 0.63
9 0.55
10 0.5
11 0.46
12 0.42
13 0.41
14 0.36
15 0.38
16 0.44
17 0.47
18 0.53
19 0.59
20 0.59
21 0.61
22 0.6
23 0.59
24 0.55
25 0.58
26 0.55
27 0.56
28 0.51
29 0.45
30 0.43
31 0.36
32 0.33
33 0.26
34 0.23
35 0.14
36 0.13
37 0.11
38 0.1
39 0.09
40 0.08
41 0.08
42 0.06
43 0.07
44 0.07
45 0.07
46 0.07
47 0.09
48 0.09
49 0.09
50 0.1
51 0.08
52 0.08
53 0.09
54 0.12
55 0.15
56 0.17
57 0.19
58 0.21
59 0.22
60 0.23
61 0.25
62 0.23
63 0.19
64 0.2
65 0.2
66 0.22
67 0.21
68 0.25
69 0.26
70 0.34
71 0.37
72 0.38
73 0.43
74 0.47
75 0.56
76 0.61
77 0.65
78 0.66
79 0.7
80 0.75
81 0.78
82 0.78
83 0.79
84 0.8
85 0.81
86 0.84
87 0.82
88 0.81
89 0.81
90 0.81
91 0.81
92 0.8
93 0.8
94 0.72
95 0.76
96 0.71
97 0.66
98 0.64
99 0.57
100 0.51