Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A068RJ10

Protein Details
Accession A0A068RJ10    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
77-98SRYSRGHRKSLHKVPKFTKKTEBasic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGAFRPSFVAQGGLLWKNPFRMSATRKANVRKRLRAVDQVIATVADSGVECKALDKALALPKESEMMARDKYTVFSRYSRGHRKSLHKVPKFTKKTERTSPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.19
4 0.2
5 0.21
6 0.22
7 0.21
8 0.2
9 0.27
10 0.32
11 0.4
12 0.46
13 0.48
14 0.54
15 0.62
16 0.66
17 0.68
18 0.71
19 0.69
20 0.68
21 0.71
22 0.7
23 0.68
24 0.64
25 0.59
26 0.5
27 0.42
28 0.35
29 0.27
30 0.22
31 0.14
32 0.1
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.05
44 0.09
45 0.13
46 0.15
47 0.15
48 0.15
49 0.15
50 0.16
51 0.16
52 0.13
53 0.1
54 0.12
55 0.13
56 0.13
57 0.14
58 0.13
59 0.16
60 0.18
61 0.19
62 0.19
63 0.2
64 0.24
65 0.3
66 0.39
67 0.48
68 0.49
69 0.54
70 0.6
71 0.67
72 0.72
73 0.76
74 0.78
75 0.75
76 0.8
77 0.81
78 0.84
79 0.81
80 0.79
81 0.79
82 0.77
83 0.78
84 0.79
85 0.79