Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A068SGI3

Protein Details
Accession A0A068SGI3    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
67-90DSEVKITLPKRSKKQKWDHNPMEDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008401  Apc13  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
Pfam View protein in Pfam  
PF05839  Apc13p  
Amino Acid Sequences MKAVIASLSPSIPYNLYQHMQTDSTFNYLHWDMPNLPILADEWIGLQIPEEPIAVPEEYDAAQNDDDSEVKITLPKRSKKQKWDHNPMED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.19
4 0.19
5 0.2
6 0.21
7 0.21
8 0.2
9 0.19
10 0.16
11 0.17
12 0.17
13 0.15
14 0.17
15 0.16
16 0.18
17 0.16
18 0.17
19 0.15
20 0.16
21 0.2
22 0.15
23 0.14
24 0.13
25 0.12
26 0.11
27 0.1
28 0.08
29 0.05
30 0.05
31 0.05
32 0.05
33 0.04
34 0.04
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.07
41 0.07
42 0.06
43 0.06
44 0.06
45 0.07
46 0.08
47 0.08
48 0.08
49 0.08
50 0.08
51 0.09
52 0.09
53 0.09
54 0.09
55 0.1
56 0.09
57 0.09
58 0.13
59 0.14
60 0.22
61 0.31
62 0.38
63 0.47
64 0.58
65 0.67
66 0.74
67 0.84
68 0.86
69 0.89
70 0.92