Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068RNQ1

Protein Details
Accession A0A068RNQ1   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSSTGPSPSQQQKQQQPRRSGGNAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR047260  ERCC1-like_central_dom  
IPR004579  ERCC1/RAD10/SWI10  
IPR029064  L30e-like  
IPR011335  Restrct_endonuc-II-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR000530  Ribosomal_S12e  
IPR010994  RuvA_2-like  
Gene Ontology GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003684  F:damaged DNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006302  P:double-strand break repair  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF03834  Rad10  
PF01248  Ribosomal_L7Ae  
PROSITE View protein in PROSITE  
PS01189  RIBOSOMAL_S12E  
CDD cd22325  ERCC1_C-like  
Amino Acid Sequences MSSTGPSPSQQQKQQQPRRSGGNAILVNYARQKENPVLRLVHNVPWEPSDVIRCDFAVGQTTGVLYLSLRYHRLNPGYIYDRMSSMARMYVLRILLVLVDIDNYHDVLRELNRSAILNNYTMVLAWSKEEAARYLETYKAFENKSPDLIRERPVDDFYAQMTDALTHVRSVNKTDVLTLLSSFGSLHGIASASTDQLAMCPGFGEQKRYAEWEVNKLLGEQHPEASSFLQERIIMSAEEDIVMETQEVEVAAEATQGQMSVEDALQEVLRRALVHDGLARGLKQAVKALDRRQAHLAVLNESCTEGEYVKLVEALCAEHNINLIKVSDPKKLGEWVGQCKIDREGNARKVVGCSCVAVTDFGEESEAMNVLLDYFKSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.83
4 0.81
5 0.81
6 0.75
7 0.69
8 0.63
9 0.62
10 0.55
11 0.48
12 0.46
13 0.38
14 0.37
15 0.36
16 0.34
17 0.27
18 0.26
19 0.29
20 0.32
21 0.4
22 0.42
23 0.41
24 0.42
25 0.42
26 0.49
27 0.48
28 0.45
29 0.41
30 0.39
31 0.35
32 0.33
33 0.34
34 0.27
35 0.26
36 0.25
37 0.23
38 0.23
39 0.22
40 0.21
41 0.2
42 0.19
43 0.18
44 0.18
45 0.16
46 0.15
47 0.14
48 0.14
49 0.12
50 0.11
51 0.11
52 0.05
53 0.08
54 0.1
55 0.12
56 0.15
57 0.17
58 0.21
59 0.27
60 0.3
61 0.31
62 0.3
63 0.34
64 0.36
65 0.37
66 0.36
67 0.31
68 0.28
69 0.27
70 0.26
71 0.2
72 0.16
73 0.15
74 0.13
75 0.13
76 0.13
77 0.14
78 0.14
79 0.13
80 0.12
81 0.1
82 0.09
83 0.09
84 0.07
85 0.04
86 0.04
87 0.04
88 0.05
89 0.06
90 0.06
91 0.06
92 0.07
93 0.07
94 0.09
95 0.11
96 0.13
97 0.13
98 0.14
99 0.15
100 0.15
101 0.16
102 0.18
103 0.17
104 0.15
105 0.14
106 0.13
107 0.12
108 0.12
109 0.12
110 0.08
111 0.07
112 0.07
113 0.07
114 0.07
115 0.08
116 0.09
117 0.09
118 0.11
119 0.12
120 0.13
121 0.14
122 0.16
123 0.16
124 0.17
125 0.17
126 0.2
127 0.2
128 0.21
129 0.25
130 0.23
131 0.28
132 0.27
133 0.28
134 0.29
135 0.3
136 0.32
137 0.3
138 0.3
139 0.26
140 0.27
141 0.26
142 0.21
143 0.19
144 0.16
145 0.13
146 0.12
147 0.1
148 0.09
149 0.07
150 0.07
151 0.07
152 0.07
153 0.06
154 0.07
155 0.1
156 0.1
157 0.13
158 0.15
159 0.16
160 0.16
161 0.16
162 0.15
163 0.14
164 0.14
165 0.11
166 0.09
167 0.07
168 0.07
169 0.07
170 0.06
171 0.06
172 0.05
173 0.05
174 0.04
175 0.04
176 0.04
177 0.05
178 0.05
179 0.04
180 0.05
181 0.05
182 0.04
183 0.04
184 0.05
185 0.04
186 0.04
187 0.04
188 0.04
189 0.1
190 0.1
191 0.15
192 0.16
193 0.18
194 0.19
195 0.21
196 0.22
197 0.22
198 0.23
199 0.24
200 0.24
201 0.23
202 0.22
203 0.2
204 0.21
205 0.17
206 0.19
207 0.14
208 0.14
209 0.14
210 0.15
211 0.15
212 0.14
213 0.14
214 0.11
215 0.1
216 0.1
217 0.1
218 0.09
219 0.1
220 0.1
221 0.09
222 0.08
223 0.08
224 0.07
225 0.07
226 0.07
227 0.06
228 0.05
229 0.05
230 0.05
231 0.04
232 0.04
233 0.04
234 0.04
235 0.03
236 0.03
237 0.04
238 0.04
239 0.04
240 0.04
241 0.04
242 0.04
243 0.04
244 0.04
245 0.03
246 0.04
247 0.05
248 0.05
249 0.05
250 0.05
251 0.06
252 0.06
253 0.07
254 0.07
255 0.06
256 0.07
257 0.07
258 0.08
259 0.1
260 0.11
261 0.12
262 0.13
263 0.13
264 0.15
265 0.15
266 0.15
267 0.12
268 0.14
269 0.14
270 0.13
271 0.16
272 0.18
273 0.22
274 0.27
275 0.32
276 0.37
277 0.38
278 0.4
279 0.4
280 0.39
281 0.35
282 0.34
283 0.31
284 0.27
285 0.26
286 0.24
287 0.2
288 0.18
289 0.17
290 0.13
291 0.12
292 0.08
293 0.08
294 0.08
295 0.09
296 0.08
297 0.1
298 0.09
299 0.09
300 0.09
301 0.11
302 0.1
303 0.12
304 0.12
305 0.11
306 0.14
307 0.14
308 0.14
309 0.13
310 0.13
311 0.13
312 0.2
313 0.24
314 0.28
315 0.29
316 0.3
317 0.32
318 0.35
319 0.35
320 0.35
321 0.38
322 0.4
323 0.45
324 0.47
325 0.45
326 0.44
327 0.46
328 0.43
329 0.39
330 0.39
331 0.42
332 0.45
333 0.51
334 0.5
335 0.47
336 0.46
337 0.44
338 0.4
339 0.31
340 0.26
341 0.2
342 0.21
343 0.2
344 0.18
345 0.16
346 0.15
347 0.14
348 0.13
349 0.13
350 0.11
351 0.11
352 0.11
353 0.11
354 0.08
355 0.08
356 0.08
357 0.07
358 0.08