Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068SGG8

Protein Details
Accession A0A068SGG8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-131LAEAPKGGRKQRKEKKNRAKKFRGTKKAKAAAGKKBasic
NLS Segment(s)
PositionSequence
98-131AEAPKGGRKQRKEKKNRAKKFRGTKKAKAAAGKK
Subcellular Location(s) mito 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADATVTIRTRKFLTNRLLQRKQMVVDVIHPARPSISKDELREKLAKMYKANKEVISVFGFKTHFGGGKTTGFALIYDNVEALKKFEPKYRLVRIGLAEAPKGGRKQRKEKKNRAKKFRGTKKAKAAAGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.61
4 0.69
5 0.72
6 0.68
7 0.68
8 0.64
9 0.57
10 0.5
11 0.42
12 0.33
13 0.29
14 0.33
15 0.29
16 0.27
17 0.26
18 0.22
19 0.21
20 0.22
21 0.22
22 0.2
23 0.26
24 0.28
25 0.32
26 0.41
27 0.43
28 0.45
29 0.45
30 0.4
31 0.41
32 0.42
33 0.41
34 0.37
35 0.43
36 0.45
37 0.47
38 0.49
39 0.41
40 0.38
41 0.35
42 0.33
43 0.27
44 0.21
45 0.16
46 0.16
47 0.16
48 0.14
49 0.14
50 0.12
51 0.11
52 0.11
53 0.12
54 0.11
55 0.12
56 0.12
57 0.11
58 0.1
59 0.09
60 0.08
61 0.08
62 0.08
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.08
70 0.1
71 0.14
72 0.15
73 0.21
74 0.25
75 0.3
76 0.38
77 0.44
78 0.46
79 0.44
80 0.45
81 0.42
82 0.42
83 0.39
84 0.32
85 0.25
86 0.2
87 0.21
88 0.21
89 0.23
90 0.27
91 0.32
92 0.4
93 0.51
94 0.6
95 0.7
96 0.78
97 0.86
98 0.89
99 0.92
100 0.94
101 0.94
102 0.94
103 0.94
104 0.94
105 0.94
106 0.93
107 0.91
108 0.9
109 0.9
110 0.88
111 0.83