Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A068RFD2

Protein Details
Accession A0A068RFD2    Localization Confidence High Confidence Score 19.9
NoLS Segment(s)
PositionSequenceProtein Nature
27-54RSPMGKSAKFYKRPTRKEKESRTLNKVAHydrophilic
84-103VDPPVQKKAKKNSSDNDKPDHydrophilic
NLS Segment(s)
PositionSequence
34-53AKFYKRPTRKEKESRTLNKV
57-72AASVQKKTKQKSEKKK
112-122RTYKKVPPKRK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MDGLDLPLCPVHTHSTLSRFYSHTPTRSPMGKSAKFYKRPTRKEKESRTLNKVADPAASVQKKTKQKSEKKKEIVTTATVAMDVDPPVQKKAKKNSSDNDKPDYVDLFSGKRTYKKVPPKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.31
4 0.32
5 0.33
6 0.3
7 0.32
8 0.38
9 0.39
10 0.37
11 0.37
12 0.38
13 0.4
14 0.43
15 0.42
16 0.41
17 0.46
18 0.46
19 0.48
20 0.54
21 0.59
22 0.62
23 0.67
24 0.69
25 0.7
26 0.76
27 0.81
28 0.81
29 0.82
30 0.84
31 0.87
32 0.86
33 0.86
34 0.84
35 0.81
36 0.78
37 0.68
38 0.6
39 0.51
40 0.41
41 0.31
42 0.24
43 0.19
44 0.2
45 0.2
46 0.18
47 0.19
48 0.26
49 0.33
50 0.35
51 0.42
52 0.45
53 0.54
54 0.65
55 0.73
56 0.76
57 0.76
58 0.8
59 0.75
60 0.7
61 0.62
62 0.53
63 0.44
64 0.34
65 0.27
66 0.21
67 0.17
68 0.12
69 0.1
70 0.08
71 0.08
72 0.09
73 0.11
74 0.14
75 0.19
76 0.23
77 0.3
78 0.4
79 0.48
80 0.55
81 0.62
82 0.68
83 0.74
84 0.8
85 0.77
86 0.73
87 0.65
88 0.58
89 0.52
90 0.44
91 0.34
92 0.27
93 0.24
94 0.19
95 0.2
96 0.23
97 0.25
98 0.28
99 0.32
100 0.37
101 0.45
102 0.55