Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068S805

Protein Details
Accession A0A068S805    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-26VTPVVKHKIIKKRTAPFKRHQSDRFHydrophilic
NLS Segment(s)
PositionSequence
8-55HKIIKKRTAPFKRHQSDRFARVGESWRKPKGIDNAMRRRFKGQAAMPK
Subcellular Location(s) mito 16.5, cyto_mito 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVTPVVKHKIIKKRTAPFKRHQSDRFARVGESWRKPKGIDNAMRRRFKGQAAMPKIGYGSAKKTRHMLPNGFRKFTVSNVKQLDLLLMHNRSYAAEIAHNVCAKKRVEIIERAAQLNVKVINAGARLRSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.84
3 0.83
4 0.83
5 0.86
6 0.85
7 0.85
8 0.8
9 0.79
10 0.77
11 0.75
12 0.7
13 0.6
14 0.52
15 0.45
16 0.49
17 0.48
18 0.48
19 0.48
20 0.46
21 0.46
22 0.46
23 0.5
24 0.5
25 0.51
26 0.51
27 0.54
28 0.62
29 0.69
30 0.72
31 0.67
32 0.61
33 0.54
34 0.48
35 0.45
36 0.4
37 0.41
38 0.43
39 0.45
40 0.41
41 0.39
42 0.36
43 0.29
44 0.24
45 0.16
46 0.16
47 0.23
48 0.24
49 0.25
50 0.29
51 0.32
52 0.38
53 0.42
54 0.42
55 0.41
56 0.5
57 0.53
58 0.5
59 0.45
60 0.41
61 0.37
62 0.36
63 0.38
64 0.29
65 0.33
66 0.34
67 0.35
68 0.33
69 0.32
70 0.27
71 0.18
72 0.18
73 0.15
74 0.15
75 0.14
76 0.14
77 0.14
78 0.13
79 0.14
80 0.13
81 0.09
82 0.1
83 0.11
84 0.13
85 0.17
86 0.19
87 0.18
88 0.18
89 0.23
90 0.22
91 0.23
92 0.26
93 0.28
94 0.32
95 0.37
96 0.43
97 0.45
98 0.46
99 0.45
100 0.41
101 0.36
102 0.31
103 0.29
104 0.24
105 0.16
106 0.14
107 0.13
108 0.15
109 0.16
110 0.18
111 0.16