Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A068RXI2

Protein Details
Accession A0A068RXI2    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-36HRNGIKKPRQHRYPSLKGGRBasic
NLS Segment(s)
PositionSequence
21-25IKKPR
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNSKAHRNGIKKPRQHRYPSLKGGRQVPSQPALCQEGHSQGSCCQEEGISSYYSINKCLMAKYGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.72
3 0.71
4 0.68
5 0.65
6 0.67
7 0.72
8 0.72
9 0.71
10 0.75
11 0.78
12 0.79
13 0.79
14 0.79
15 0.78
16 0.79
17 0.8
18 0.79
19 0.72
20 0.67
21 0.66
22 0.6
23 0.53
24 0.45
25 0.38
26 0.34
27 0.31
28 0.28
29 0.24
30 0.23
31 0.2
32 0.19
33 0.18
34 0.18
35 0.19
36 0.2
37 0.19
38 0.19
39 0.24
40 0.23
41 0.22
42 0.17
43 0.16
44 0.15
45 0.17
46 0.17
47 0.12
48 0.12
49 0.13
50 0.18
51 0.19
52 0.2
53 0.18
54 0.19
55 0.19
56 0.2