Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068RM68

Protein Details
Accession A0A068RM68   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
2-33PLLSPNYPTHDRKKKKKSKKDKEKITRAITEEBasic
NLS Segment(s)
PositionSequence
13-26RKKKKKSKKDKEKI
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Amino Acid Sequences MPLLSPNYPTHDRKKKKKSKKDKEKITRAITEEGESPQRVHMIEKTEAEKKFEETQRKRQMERIAKAAAKSHKEKVSEFNNKLEQLSEHYDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.87
4 0.93
5 0.94
6 0.95
7 0.96
8 0.96
9 0.96
10 0.96
11 0.95
12 0.93
13 0.88
14 0.82
15 0.74
16 0.67
17 0.56
18 0.46
19 0.37
20 0.3
21 0.26
22 0.21
23 0.18
24 0.15
25 0.15
26 0.14
27 0.14
28 0.14
29 0.16
30 0.17
31 0.19
32 0.21
33 0.26
34 0.26
35 0.27
36 0.25
37 0.23
38 0.28
39 0.32
40 0.4
41 0.4
42 0.5
43 0.58
44 0.62
45 0.6
46 0.59
47 0.64
48 0.63
49 0.6
50 0.54
51 0.49
52 0.46
53 0.46
54 0.47
55 0.43
56 0.39
57 0.41
58 0.42
59 0.42
60 0.43
61 0.44
62 0.45
63 0.49
64 0.54
65 0.52
66 0.52
67 0.52
68 0.51
69 0.5
70 0.44
71 0.34
72 0.3
73 0.34
74 0.29
75 0.26
76 0.26
77 0.27
78 0.26