Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C9A1

Protein Details
Accession Q6C9A1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
63-88LARSRSRTGRKIIKRRTLKGRWFLTHHydrophilic
NLS Segment(s)
PositionSequence
54-83RKRKRSLGFLARSRSRTGRKIIKRRTLKGR
Subcellular Location(s) extr 10, mito 8, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG yli:YALI0D12793g  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MIQPNSVPSCIPAASGVASALAQGSTATLPFLTPFSGASQRRYVRGIDYQPSVRKRKRSLGFLARSRSRTGRKIIKRRTLKGRWFLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.08
5 0.08
6 0.07
7 0.06
8 0.05
9 0.04
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.05
18 0.06
19 0.05
20 0.05
21 0.06
22 0.09
23 0.16
24 0.18
25 0.2
26 0.27
27 0.28
28 0.29
29 0.3
30 0.28
31 0.23
32 0.27
33 0.27
34 0.23
35 0.25
36 0.27
37 0.32
38 0.38
39 0.44
40 0.43
41 0.48
42 0.51
43 0.58
44 0.6
45 0.61
46 0.64
47 0.66
48 0.69
49 0.68
50 0.71
51 0.67
52 0.62
53 0.6
54 0.58
55 0.54
56 0.51
57 0.54
58 0.56
59 0.61
60 0.7
61 0.76
62 0.79
63 0.83
64 0.86
65 0.88
66 0.87
67 0.86
68 0.85