Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068SF56

Protein Details
Accession A0A068SF56   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
68-87KNPNCGKRARVKTKKGSVTVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, mito 3, pero 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009009  RlpA-like_DPBB  
IPR036908  RlpA-like_sf  
Pfam View protein in Pfam  
PF03330  DPBB_1  
CDD cd22191  DPBB_RlpA_EXP_N-like  
Amino Acid Sequences MRYQLCFLVVFLLGALAAPIERRKSSQFSGDLTYYTPGLGSCGETNTAKDLIAALNAPQMANGDNPNKNPNCGKRARVKTKKGSVTVKIVDTCPPCKSGDLDLSPAAFQRLGDFDDGRIEGTWEWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.03
4 0.03
5 0.05
6 0.08
7 0.12
8 0.13
9 0.16
10 0.21
11 0.26
12 0.29
13 0.35
14 0.35
15 0.34
16 0.38
17 0.36
18 0.32
19 0.27
20 0.25
21 0.18
22 0.15
23 0.12
24 0.07
25 0.08
26 0.07
27 0.08
28 0.07
29 0.08
30 0.1
31 0.1
32 0.11
33 0.12
34 0.12
35 0.1
36 0.1
37 0.1
38 0.08
39 0.08
40 0.07
41 0.05
42 0.06
43 0.06
44 0.06
45 0.05
46 0.06
47 0.06
48 0.07
49 0.09
50 0.12
51 0.13
52 0.15
53 0.21
54 0.21
55 0.23
56 0.27
57 0.29
58 0.32
59 0.35
60 0.39
61 0.43
62 0.53
63 0.62
64 0.67
65 0.71
66 0.74
67 0.79
68 0.8
69 0.77
70 0.73
71 0.66
72 0.63
73 0.57
74 0.5
75 0.43
76 0.37
77 0.36
78 0.33
79 0.31
80 0.26
81 0.25
82 0.23
83 0.23
84 0.24
85 0.24
86 0.28
87 0.27
88 0.29
89 0.28
90 0.28
91 0.27
92 0.25
93 0.21
94 0.14
95 0.11
96 0.11
97 0.12
98 0.12
99 0.15
100 0.15
101 0.14
102 0.18
103 0.19
104 0.18
105 0.16
106 0.16