Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C4L8

Protein Details
Accession Q6C4L8    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
19-42NSMPKKFRNSSWKAPKNRNKNIKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0034080  P:CENP-A containing chromatin assembly  
GO:0006338  P:chromatin remodeling  
KEGG yli:YALI0E25718g  -  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MTESSNPQAPPTIAEANANSMPKKFRNSSWKAPKNRNKNIKAIIAEEQRRLADKNLGIDDITYFNIDAPPSLIPSKAYCDITGLEGKYRSPSTNLRFYNQEVAQVVRDIPPGVDQQYLELRGANIILR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.24
4 0.27
5 0.27
6 0.22
7 0.21
8 0.25
9 0.27
10 0.33
11 0.32
12 0.36
13 0.45
14 0.52
15 0.61
16 0.68
17 0.73
18 0.75
19 0.82
20 0.84
21 0.84
22 0.87
23 0.86
24 0.8
25 0.79
26 0.76
27 0.71
28 0.63
29 0.55
30 0.51
31 0.48
32 0.46
33 0.39
34 0.35
35 0.29
36 0.29
37 0.27
38 0.22
39 0.19
40 0.17
41 0.19
42 0.18
43 0.18
44 0.17
45 0.15
46 0.15
47 0.11
48 0.1
49 0.07
50 0.06
51 0.06
52 0.07
53 0.07
54 0.06
55 0.06
56 0.05
57 0.07
58 0.08
59 0.08
60 0.08
61 0.09
62 0.13
63 0.15
64 0.16
65 0.14
66 0.15
67 0.16
68 0.17
69 0.19
70 0.16
71 0.15
72 0.15
73 0.15
74 0.17
75 0.18
76 0.17
77 0.18
78 0.26
79 0.29
80 0.38
81 0.4
82 0.39
83 0.41
84 0.42
85 0.46
86 0.39
87 0.37
88 0.29
89 0.28
90 0.26
91 0.24
92 0.22
93 0.16
94 0.17
95 0.13
96 0.12
97 0.13
98 0.15
99 0.15
100 0.17
101 0.15
102 0.17
103 0.22
104 0.24
105 0.21
106 0.2
107 0.18
108 0.17