Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068RKE2

Protein Details
Accession A0A068RKE2    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-34PSSSSGGKKAKKKWSAKKVKDKANNMVVHydrophilic
NLS Segment(s)
PositionSequence
12-27GGKKAKKKWSAKKVKD
Subcellular Location(s) nucl 12, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MGKQAVPSSSSGGKKAKKKWSAKKVKDKANNMVVLDKPTYERLFKEVPTYKLITQSVLVDRLRLNGSLARIAIRELESQGLIKPLVQHHRQVIYTRATGDEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.56
3 0.62
4 0.65
5 0.74
6 0.8
7 0.83
8 0.87
9 0.9
10 0.92
11 0.9
12 0.91
13 0.9
14 0.85
15 0.82
16 0.78
17 0.71
18 0.6
19 0.55
20 0.45
21 0.38
22 0.32
23 0.24
24 0.18
25 0.18
26 0.19
27 0.16
28 0.16
29 0.18
30 0.19
31 0.19
32 0.26
33 0.27
34 0.28
35 0.3
36 0.32
37 0.28
38 0.3
39 0.3
40 0.22
41 0.18
42 0.18
43 0.16
44 0.17
45 0.17
46 0.14
47 0.14
48 0.15
49 0.15
50 0.14
51 0.14
52 0.12
53 0.13
54 0.13
55 0.14
56 0.12
57 0.11
58 0.11
59 0.12
60 0.12
61 0.12
62 0.11
63 0.12
64 0.12
65 0.12
66 0.12
67 0.12
68 0.11
69 0.1
70 0.13
71 0.18
72 0.26
73 0.28
74 0.32
75 0.36
76 0.41
77 0.43
78 0.42
79 0.42
80 0.39
81 0.38
82 0.35
83 0.34