Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068RIX6

Protein Details
Accession A0A068RIX6   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
74-101LSIISTHHQKRKRARVKKDDPLPRQQQQHydrophilic
NLS Segment(s)
PositionSequence
83-91KRKRARVKK
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MNWTGGQRNNNLGCREGNRVANPIKQRLQRLKQLRLDLACSKVHAAKPQATRTSRAPPYCLFDLTGNVQHFKHLSIISTHHQKRKRARVKKDDPLPRQQQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.4
4 0.39
5 0.35
6 0.39
7 0.4
8 0.43
9 0.44
10 0.44
11 0.46
12 0.46
13 0.53
14 0.57
15 0.6
16 0.63
17 0.67
18 0.69
19 0.68
20 0.67
21 0.63
22 0.54
23 0.52
24 0.45
25 0.4
26 0.32
27 0.26
28 0.23
29 0.22
30 0.22
31 0.21
32 0.22
33 0.25
34 0.29
35 0.34
36 0.39
37 0.37
38 0.39
39 0.38
40 0.44
41 0.43
42 0.39
43 0.37
44 0.32
45 0.36
46 0.34
47 0.31
48 0.24
49 0.19
50 0.2
51 0.2
52 0.24
53 0.2
54 0.2
55 0.19
56 0.19
57 0.19
58 0.18
59 0.18
60 0.13
61 0.13
62 0.14
63 0.18
64 0.23
65 0.33
66 0.38
67 0.43
68 0.49
69 0.56
70 0.65
71 0.72
72 0.77
73 0.77
74 0.82
75 0.86
76 0.89
77 0.92
78 0.92
79 0.91
80 0.87
81 0.87