Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068S4I3

Protein Details
Accession A0A068S4I3    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
48-70QECMSKPVKKTKAKNTINYHLARHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 10.5, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MKLKQLKVRPRKLLESSPCVVEMGALFECWATDGIDAKKCTAAAQSLQECMSKPVKKTKAKNTINYHLARLSKQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.7
3 0.62
4 0.54
5 0.47
6 0.39
7 0.32
8 0.23
9 0.15
10 0.12
11 0.1
12 0.08
13 0.07
14 0.07
15 0.07
16 0.07
17 0.07
18 0.05
19 0.05
20 0.08
21 0.1
22 0.15
23 0.15
24 0.15
25 0.15
26 0.15
27 0.15
28 0.13
29 0.13
30 0.1
31 0.16
32 0.16
33 0.17
34 0.18
35 0.18
36 0.17
37 0.2
38 0.25
39 0.23
40 0.25
41 0.34
42 0.43
43 0.52
44 0.6
45 0.68
46 0.71
47 0.76
48 0.83
49 0.82
50 0.81
51 0.8
52 0.74
53 0.66
54 0.6
55 0.55