Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A068S0A3

Protein Details
Accession A0A068S0A3    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
29-53ILTFTQCHHQPRRKKNSRGRPDSIWHydrophilic
NLS Segment(s)
PositionSequence
42-43KK
Subcellular Location(s) mito 20, nucl 2, cyto 2, extr 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MKGGVSNRTKLLVGVKRTLGASFTIVVAILTFTQCHHQPRRKKNSRGRPDSIWLVVTLGESENGHDDRETCTQGALHPDEQLCSIEDPTFHCRISSYGHLSVIHML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.36
4 0.36
5 0.35
6 0.26
7 0.2
8 0.17
9 0.12
10 0.11
11 0.1
12 0.09
13 0.08
14 0.07
15 0.06
16 0.05
17 0.05
18 0.05
19 0.05
20 0.09
21 0.12
22 0.19
23 0.28
24 0.36
25 0.45
26 0.56
27 0.67
28 0.74
29 0.82
30 0.85
31 0.87
32 0.9
33 0.89
34 0.83
35 0.75
36 0.69
37 0.62
38 0.52
39 0.41
40 0.3
41 0.22
42 0.17
43 0.12
44 0.08
45 0.06
46 0.05
47 0.05
48 0.05
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.12
55 0.15
56 0.16
57 0.13
58 0.13
59 0.13
60 0.15
61 0.2
62 0.19
63 0.17
64 0.18
65 0.19
66 0.19
67 0.2
68 0.19
69 0.15
70 0.13
71 0.13
72 0.12
73 0.12
74 0.16
75 0.21
76 0.23
77 0.21
78 0.2
79 0.2
80 0.21
81 0.26
82 0.29
83 0.3
84 0.3
85 0.32
86 0.33