Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068S688

Protein Details
Accession A0A068S688   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
105-127SDFDRFKVQKLKNKRRVAVNSAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR014722  Rib_L2_dom2  
IPR002784  Ribosomal_L14e_dom  
IPR039660  Ribosomal_protein_L14  
IPR041985  RPL14_KOW  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01929  Ribosomal_L14e  
CDD cd06088  KOW_RPL14  
Amino Acid Sequences MVQGSFKRQVEVGRVVLLNNNKLAVIIDIVDHKRVLIDGPTTGVARQAWTLRHLTLTNLVVKGLPRNAGQSTVKKCLEKNDTLNTWAKSAWAQKLAQRQVRANLSDFDRFKVQKLKNKRRVAVNSAVAAAKKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.31
4 0.32
5 0.28
6 0.23
7 0.22
8 0.18
9 0.17
10 0.18
11 0.13
12 0.1
13 0.07
14 0.07
15 0.12
16 0.13
17 0.14
18 0.13
19 0.13
20 0.12
21 0.12
22 0.12
23 0.09
24 0.1
25 0.09
26 0.1
27 0.12
28 0.12
29 0.12
30 0.13
31 0.1
32 0.1
33 0.11
34 0.12
35 0.12
36 0.14
37 0.16
38 0.15
39 0.17
40 0.16
41 0.15
42 0.17
43 0.17
44 0.17
45 0.15
46 0.15
47 0.14
48 0.14
49 0.15
50 0.12
51 0.12
52 0.1
53 0.12
54 0.12
55 0.16
56 0.18
57 0.22
58 0.26
59 0.3
60 0.32
61 0.31
62 0.32
63 0.35
64 0.39
65 0.37
66 0.38
67 0.38
68 0.37
69 0.39
70 0.43
71 0.36
72 0.31
73 0.26
74 0.22
75 0.19
76 0.22
77 0.22
78 0.21
79 0.22
80 0.25
81 0.34
82 0.41
83 0.43
84 0.43
85 0.43
86 0.45
87 0.49
88 0.48
89 0.4
90 0.37
91 0.35
92 0.39
93 0.37
94 0.33
95 0.35
96 0.33
97 0.35
98 0.41
99 0.45
100 0.47
101 0.57
102 0.66
103 0.7
104 0.79
105 0.81
106 0.81
107 0.82
108 0.8
109 0.78
110 0.72
111 0.64
112 0.56
113 0.52
114 0.42