Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068S4N3

Protein Details
Accession A0A068S4N3    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
12-38QTKSHTLCRRCGKRSFHKQKKTCASCGHydrophilic
NLS Segment(s)
PositionSequence
52-58KAKRRRT
Subcellular Location(s) mito 13, nucl 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTQSFGKRQTKSHTLCRRCGKRSFHKQKKTCASCGFPAAKMRRFNWSEKAKRRRTTGTGRMSYLKKVHRRFTNGFREGTQAKKQQKAEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.68
3 0.69
4 0.65
5 0.72
6 0.77
7 0.78
8 0.74
9 0.77
10 0.75
11 0.76
12 0.81
13 0.83
14 0.83
15 0.85
16 0.85
17 0.87
18 0.88
19 0.82
20 0.78
21 0.72
22 0.65
23 0.56
24 0.57
25 0.48
26 0.39
27 0.41
28 0.38
29 0.39
30 0.38
31 0.37
32 0.38
33 0.4
34 0.41
35 0.43
36 0.48
37 0.51
38 0.58
39 0.67
40 0.68
41 0.7
42 0.73
43 0.7
44 0.67
45 0.68
46 0.67
47 0.67
48 0.61
49 0.59
50 0.59
51 0.54
52 0.52
53 0.49
54 0.48
55 0.47
56 0.51
57 0.57
58 0.6
59 0.66
60 0.68
61 0.72
62 0.74
63 0.69
64 0.65
65 0.57
66 0.55
67 0.5
68 0.5
69 0.48
70 0.46
71 0.49
72 0.55