Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A068RHM4

Protein Details
Accession A0A068RHM4    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
119-147EVQLCHAPPRRHRPIRRFWKWRSHGNGAKHydrophilic
NLS Segment(s)
PositionSequence
128-141RRHRPIRRFWKWRS
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 8, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MDSTLGNEGCVRAQCIGCRVRWPRFFSYLIWRYKQWQWLSRVPLVWCFRNKEQQWQPFEMKNQAILWQSYNEPQHPYYSHECHIRDRAIESGREVVRVVVQEHVAFSMHPDWSEPIVYEVQLCHAPPRRHRPIRRFWKWRSHGNGAKVKDEALLAEQHDRSGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.26
3 0.28
4 0.27
5 0.35
6 0.41
7 0.47
8 0.53
9 0.57
10 0.56
11 0.57
12 0.58
13 0.52
14 0.55
15 0.54
16 0.53
17 0.49
18 0.45
19 0.45
20 0.48
21 0.53
22 0.49
23 0.48
24 0.48
25 0.52
26 0.56
27 0.55
28 0.53
29 0.46
30 0.48
31 0.44
32 0.43
33 0.4
34 0.4
35 0.41
36 0.47
37 0.47
38 0.5
39 0.55
40 0.57
41 0.59
42 0.58
43 0.58
44 0.51
45 0.52
46 0.47
47 0.38
48 0.32
49 0.27
50 0.25
51 0.23
52 0.2
53 0.18
54 0.15
55 0.15
56 0.17
57 0.19
58 0.17
59 0.18
60 0.18
61 0.19
62 0.18
63 0.22
64 0.23
65 0.25
66 0.26
67 0.29
68 0.29
69 0.3
70 0.33
71 0.29
72 0.24
73 0.23
74 0.24
75 0.21
76 0.2
77 0.18
78 0.2
79 0.19
80 0.19
81 0.18
82 0.14
83 0.13
84 0.14
85 0.13
86 0.09
87 0.1
88 0.09
89 0.09
90 0.09
91 0.08
92 0.07
93 0.08
94 0.09
95 0.09
96 0.09
97 0.09
98 0.11
99 0.12
100 0.12
101 0.11
102 0.11
103 0.11
104 0.11
105 0.11
106 0.09
107 0.1
108 0.11
109 0.11
110 0.15
111 0.23
112 0.29
113 0.37
114 0.47
115 0.56
116 0.65
117 0.75
118 0.78
119 0.81
120 0.87
121 0.89
122 0.89
123 0.86
124 0.87
125 0.84
126 0.84
127 0.82
128 0.81
129 0.77
130 0.76
131 0.76
132 0.68
133 0.65
134 0.55
135 0.47
136 0.38
137 0.31
138 0.23
139 0.17
140 0.17
141 0.16
142 0.21
143 0.21