Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A068SGH3

Protein Details
Accession A0A068SGH3    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-73LPPNARLPTQHQRKKTRTRKHydrophilic
NLS Segment(s)
PositionSequence
66-73RKKTRTRK
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
Amino Acid Sequences MPHNPKANPNMATSPMISKIKRTFDQATILDDKLLEIVDQLEAVHSKMQHSPILPPNARLPTQHQRKKTRTRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.33
4 0.28
5 0.31
6 0.33
7 0.38
8 0.39
9 0.43
10 0.41
11 0.38
12 0.44
13 0.39
14 0.38
15 0.34
16 0.32
17 0.26
18 0.21
19 0.18
20 0.12
21 0.11
22 0.06
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.05
31 0.07
32 0.07
33 0.08
34 0.11
35 0.13
36 0.15
37 0.16
38 0.21
39 0.26
40 0.36
41 0.35
42 0.35
43 0.39
44 0.42
45 0.42
46 0.38
47 0.4
48 0.41
49 0.52
50 0.57
51 0.61
52 0.67
53 0.76