Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068S9D1

Protein Details
Accession A0A068S9D1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTCKRRNNGRNKHGRGHNKFVRCBasic
NLS Segment(s)
PositionSequence
93-107RNRAPPPRFRFAKKA
Subcellular Location(s) mito 17.5, mito_nucl 11.333, cyto 5.5, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTCKRRNNGRNKHGRGHNKFVRCINCSRCVPKDKAIKRFNVRNMVEAAAVRDLQEASVYEEYTIPKLYVKLHYCVSCAIHARVVRVRSVVDRRNRAPPPRFRFAKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.85
3 0.84
4 0.82
5 0.77
6 0.75
7 0.72
8 0.68
9 0.61
10 0.61
11 0.56
12 0.55
13 0.54
14 0.55
15 0.55
16 0.55
17 0.55
18 0.56
19 0.6
20 0.6
21 0.65
22 0.65
23 0.66
24 0.67
25 0.71
26 0.69
27 0.69
28 0.62
29 0.54
30 0.5
31 0.42
32 0.35
33 0.27
34 0.21
35 0.12
36 0.11
37 0.09
38 0.08
39 0.07
40 0.06
41 0.06
42 0.06
43 0.08
44 0.08
45 0.08
46 0.08
47 0.09
48 0.1
49 0.11
50 0.11
51 0.08
52 0.08
53 0.09
54 0.11
55 0.18
56 0.2
57 0.22
58 0.25
59 0.26
60 0.26
61 0.27
62 0.26
63 0.23
64 0.23
65 0.22
66 0.22
67 0.23
68 0.25
69 0.28
70 0.28
71 0.26
72 0.24
73 0.24
74 0.27
75 0.35
76 0.39
77 0.44
78 0.51
79 0.53
80 0.62
81 0.68
82 0.7
83 0.71
84 0.74
85 0.73
86 0.75
87 0.78