Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A068S6W3

Protein Details
Accession A0A068S6W3    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MVQIAKPKKRKRAKERVPHLHSQTKBasic
NLS Segment(s)
PositionSequence
6-16KPKKRKRAKER
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MVQIAKPKKRKRAKERVPHLHSQTKLTDDDNLQSTTTAQQHALLSITVTIQQGMATVCTSEVPGLIQRYTRFLLLVLVDKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.93
3 0.94
4 0.9
5 0.87
6 0.83
7 0.79
8 0.7
9 0.63
10 0.54
11 0.46
12 0.4
13 0.32
14 0.29
15 0.22
16 0.23
17 0.21
18 0.2
19 0.17
20 0.15
21 0.15
22 0.15
23 0.15
24 0.13
25 0.1
26 0.11
27 0.11
28 0.12
29 0.11
30 0.08
31 0.07
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.05
38 0.05
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.06
46 0.06
47 0.05
48 0.05
49 0.06
50 0.09
51 0.12
52 0.13
53 0.16
54 0.17
55 0.21
56 0.23
57 0.22
58 0.19
59 0.17
60 0.19
61 0.18