Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6C3D4

Protein Details
Accession Q6C3D4    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
155-179VEAKKEPKKEEPKKEETKKEEPKKEBasic
NLS Segment(s)
PositionSequence
150-195EPKKEVEAKKEPKKEEPKKEETKKEEPKKEEALKKEEPKKDEPKKE
388-392KRRKP
416-423KRQGTKRR
Subcellular Location(s) nucl 15, cyto_nucl 12.666, mito_nucl 10.332, cyto 7, cyto_mito 6.332
Family & Domain DBs
InterPro View protein in InterPro  
IPR032710  NTF2-like_dom_sf  
IPR002075  NTF2_dom  
IPR018222  Nuclear_transport_factor_2_euk  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR039539  Ras_GTPase_bind_prot  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0005829  C:cytosol  
GO:0043229  C:intracellular organelle  
GO:1990904  C:ribonucleoprotein complex  
GO:1990861  C:Ubp3-Bre5 deubiquitination complex  
GO:0003729  F:mRNA binding  
GO:0016579  P:protein deubiquitination  
GO:0034517  P:ribophagy  
KEGG yli:YALI0F00638g  -  
Pfam View protein in Pfam  
PF02136  NTF2  
PROSITE View protein in PROSITE  
PS50177  NTF2_DOMAIN  
CDD cd00780  NTF2  
Amino Acid Sequences MSPTAEQIAWLFVSQYFKRLHSDPSELHHFYDVDAKLLHGKEQDDTAAISGTESIQERISQLHTKGCKTLISCLDAMEGPNKSILIQIIGQMSSTDDGVPQKFVQSVVLESKSGTNYSIYSDVFRFLKDDDEEVAKEDVKEEPKEDVKEEPKKEVEAKKEPKKEEPKKEETKKEEPKKEEALKKEEPKKDEPKKEAPVAAPVATPATPVAASSSSAASAAPETKEEPKKETAAAAPPAAATSAPAEPTKPSGPISWAARARSSDKPAPAGSATPAETPSPVAAAAVAKKEPSSSPTVAAATTSSASSAAGNRKGTFHSAYIKGVDGNTDLAVVEAALKKIGNGISHFEVTKSRNSVFVDFNDAQTLRKALELRELKVGDLTIIIDERKRRKPGSGSGTSNGGGSGSGSSGNRDSNKRQGTKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.25
3 0.26
4 0.27
5 0.32
6 0.33
7 0.38
8 0.37
9 0.43
10 0.4
11 0.44
12 0.51
13 0.47
14 0.47
15 0.43
16 0.37
17 0.3
18 0.36
19 0.29
20 0.22
21 0.21
22 0.21
23 0.23
24 0.24
25 0.26
26 0.21
27 0.22
28 0.21
29 0.23
30 0.23
31 0.18
32 0.18
33 0.15
34 0.13
35 0.12
36 0.1
37 0.09
38 0.08
39 0.1
40 0.11
41 0.11
42 0.11
43 0.12
44 0.13
45 0.15
46 0.19
47 0.22
48 0.22
49 0.29
50 0.33
51 0.34
52 0.37
53 0.36
54 0.35
55 0.32
56 0.38
57 0.35
58 0.34
59 0.32
60 0.29
61 0.29
62 0.26
63 0.26
64 0.22
65 0.18
66 0.14
67 0.15
68 0.15
69 0.13
70 0.14
71 0.13
72 0.11
73 0.11
74 0.13
75 0.14
76 0.14
77 0.13
78 0.12
79 0.12
80 0.1
81 0.1
82 0.08
83 0.08
84 0.11
85 0.12
86 0.14
87 0.14
88 0.14
89 0.15
90 0.15
91 0.15
92 0.13
93 0.15
94 0.18
95 0.19
96 0.18
97 0.17
98 0.19
99 0.18
100 0.18
101 0.16
102 0.12
103 0.11
104 0.13
105 0.16
106 0.14
107 0.15
108 0.15
109 0.17
110 0.16
111 0.16
112 0.15
113 0.13
114 0.17
115 0.15
116 0.16
117 0.15
118 0.17
119 0.17
120 0.19
121 0.19
122 0.15
123 0.14
124 0.14
125 0.16
126 0.17
127 0.18
128 0.17
129 0.2
130 0.24
131 0.26
132 0.26
133 0.29
134 0.33
135 0.41
136 0.42
137 0.42
138 0.39
139 0.41
140 0.46
141 0.46
142 0.45
143 0.47
144 0.55
145 0.59
146 0.66
147 0.66
148 0.69
149 0.74
150 0.76
151 0.76
152 0.76
153 0.76
154 0.79
155 0.85
156 0.84
157 0.8
158 0.81
159 0.8
160 0.81
161 0.8
162 0.74
163 0.71
164 0.7
165 0.71
166 0.66
167 0.61
168 0.59
169 0.58
170 0.62
171 0.65
172 0.62
173 0.58
174 0.6
175 0.65
176 0.67
177 0.68
178 0.66
179 0.65
180 0.66
181 0.64
182 0.59
183 0.49
184 0.44
185 0.37
186 0.31
187 0.23
188 0.17
189 0.15
190 0.12
191 0.11
192 0.07
193 0.05
194 0.05
195 0.05
196 0.06
197 0.05
198 0.06
199 0.06
200 0.07
201 0.06
202 0.06
203 0.06
204 0.05
205 0.05
206 0.06
207 0.06
208 0.06
209 0.08
210 0.15
211 0.21
212 0.22
213 0.25
214 0.26
215 0.27
216 0.27
217 0.27
218 0.22
219 0.22
220 0.22
221 0.19
222 0.16
223 0.15
224 0.14
225 0.13
226 0.1
227 0.06
228 0.06
229 0.06
230 0.08
231 0.08
232 0.08
233 0.09
234 0.12
235 0.13
236 0.13
237 0.13
238 0.13
239 0.15
240 0.19
241 0.21
242 0.25
243 0.27
244 0.26
245 0.27
246 0.28
247 0.31
248 0.32
249 0.35
250 0.33
251 0.31
252 0.34
253 0.32
254 0.32
255 0.28
256 0.23
257 0.19
258 0.16
259 0.16
260 0.14
261 0.14
262 0.12
263 0.12
264 0.12
265 0.1
266 0.08
267 0.07
268 0.06
269 0.06
270 0.07
271 0.09
272 0.1
273 0.1
274 0.1
275 0.1
276 0.12
277 0.12
278 0.14
279 0.18
280 0.17
281 0.19
282 0.21
283 0.21
284 0.2
285 0.19
286 0.16
287 0.11
288 0.11
289 0.09
290 0.07
291 0.06
292 0.07
293 0.07
294 0.12
295 0.16
296 0.2
297 0.22
298 0.23
299 0.25
300 0.26
301 0.29
302 0.27
303 0.24
304 0.26
305 0.26
306 0.28
307 0.27
308 0.26
309 0.23
310 0.21
311 0.19
312 0.13
313 0.12
314 0.1
315 0.09
316 0.08
317 0.07
318 0.07
319 0.06
320 0.08
321 0.08
322 0.08
323 0.09
324 0.09
325 0.09
326 0.12
327 0.14
328 0.14
329 0.14
330 0.19
331 0.21
332 0.23
333 0.24
334 0.21
335 0.25
336 0.25
337 0.29
338 0.29
339 0.26
340 0.29
341 0.32
342 0.35
343 0.33
344 0.32
345 0.35
346 0.32
347 0.32
348 0.32
349 0.29
350 0.26
351 0.25
352 0.24
353 0.16
354 0.19
355 0.2
356 0.16
357 0.26
358 0.3
359 0.3
360 0.37
361 0.37
362 0.33
363 0.33
364 0.32
365 0.22
366 0.18
367 0.16
368 0.1
369 0.11
370 0.12
371 0.15
372 0.22
373 0.3
374 0.38
375 0.46
376 0.47
377 0.53
378 0.61
379 0.67
380 0.69
381 0.7
382 0.68
383 0.63
384 0.64
385 0.56
386 0.48
387 0.37
388 0.27
389 0.18
390 0.12
391 0.1
392 0.07
393 0.1
394 0.1
395 0.13
396 0.16
397 0.22
398 0.27
399 0.33
400 0.38
401 0.45
402 0.55
403 0.6