Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068RX10

Protein Details
Accession A0A068RX10   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
52-78QICPSPPKGKKCPDKQKLKRIGPEGNKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, nucl 6.5, extr 6, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MVKQQPWFSLAILACYLLAGVLADCDTPPHKGKCAKGMDLVDLGSGYKCCEQICPSPPKGKKCPDKQKLKRIGPEGNKVPCCIDPSHNYKYDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.12
4 0.06
5 0.06
6 0.04
7 0.03
8 0.03
9 0.04
10 0.04
11 0.04
12 0.06
13 0.07
14 0.1
15 0.15
16 0.17
17 0.22
18 0.27
19 0.3
20 0.37
21 0.41
22 0.39
23 0.4
24 0.39
25 0.35
26 0.3
27 0.28
28 0.19
29 0.14
30 0.12
31 0.07
32 0.06
33 0.06
34 0.06
35 0.07
36 0.07
37 0.08
38 0.11
39 0.17
40 0.24
41 0.3
42 0.32
43 0.4
44 0.45
45 0.52
46 0.57
47 0.61
48 0.64
49 0.68
50 0.76
51 0.77
52 0.84
53 0.86
54 0.89
55 0.9
56 0.88
57 0.85
58 0.8
59 0.8
60 0.76
61 0.76
62 0.73
63 0.71
64 0.64
65 0.58
66 0.54
67 0.46
68 0.42
69 0.36
70 0.34
71 0.33
72 0.39
73 0.46