Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068SG60

Protein Details
Accession A0A068SG60    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
98-132LAEAPKGGRKQRKEKKNRAKKFRGTKKAKAAAGKKBasic
NLS Segment(s)
PositionSequence
99-132AEAPKGGRKQRKEKKNRAKKFRGTKKAKAAAGKK
Subcellular Location(s) mito 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADASTVTIRTRKFLTNRLLQRKQMVVDVIHPARPSISKDELREKLAKMYKANKEVISVFGFKTHFGGGKTTGFALIYDNVEALKKFEPKYRLVRIGLAEAPKGGRKQRKEKKNRAKKFRGTKKAKAAAGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.52
4 0.62
5 0.69
6 0.72
7 0.68
8 0.68
9 0.63
10 0.57
11 0.5
12 0.42
13 0.32
14 0.29
15 0.33
16 0.29
17 0.27
18 0.25
19 0.22
20 0.21
21 0.22
22 0.22
23 0.2
24 0.26
25 0.28
26 0.32
27 0.41
28 0.42
29 0.45
30 0.45
31 0.4
32 0.41
33 0.41
34 0.41
35 0.37
36 0.42
37 0.44
38 0.46
39 0.48
40 0.41
41 0.38
42 0.35
43 0.33
44 0.26
45 0.21
46 0.16
47 0.16
48 0.16
49 0.14
50 0.14
51 0.12
52 0.11
53 0.11
54 0.12
55 0.11
56 0.12
57 0.12
58 0.11
59 0.1
60 0.09
61 0.08
62 0.08
63 0.08
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.08
71 0.1
72 0.14
73 0.15
74 0.21
75 0.25
76 0.3
77 0.38
78 0.44
79 0.46
80 0.44
81 0.46
82 0.42
83 0.42
84 0.39
85 0.33
86 0.26
87 0.2
88 0.21
89 0.21
90 0.23
91 0.27
92 0.32
93 0.4
94 0.51
95 0.6
96 0.7
97 0.78
98 0.86
99 0.89
100 0.92
101 0.94
102 0.94
103 0.94
104 0.94
105 0.94
106 0.94
107 0.93
108 0.91
109 0.9
110 0.9
111 0.88
112 0.83