Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068RV26

Protein Details
Accession A0A068RV26    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
173-200IQCAQRFNQGRRNRRPGNRRPRRGQRHQHydrophilic
NLS Segment(s)
PositionSequence
140-170NKGNRPKGKGRGRAKLIRVPPRCIGGRRTRK
182-200GRRNRRPGNRRPRRGQRHQ
Subcellular Location(s) extr 24, mito 2
Family & Domain DBs
Amino Acid Sequences MRLSVLTLGVAACFVGSVFQVAHAADADPCTAIKGTCVKSKPNLAGIPCSSGEGGSYTVLGKNDCCCKDEPAPEPAETDQCTALKSTCVKSKPNLAGIPCSSGEGGSYAIVENNDCCCKDEPSDQDNPPPTTPAPNPNPNKGNRPKGKGRGRAKLIRVPPRCIGGRRTRKQIIQCAQRFNQGRRNRRPGNRRPRRGQRHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.05
5 0.05
6 0.06
7 0.07
8 0.07
9 0.08
10 0.08
11 0.09
12 0.08
13 0.09
14 0.09
15 0.08
16 0.08
17 0.09
18 0.09
19 0.08
20 0.11
21 0.17
22 0.2
23 0.27
24 0.3
25 0.33
26 0.38
27 0.45
28 0.45
29 0.45
30 0.45
31 0.4
32 0.43
33 0.4
34 0.38
35 0.32
36 0.29
37 0.22
38 0.18
39 0.16
40 0.12
41 0.11
42 0.08
43 0.08
44 0.07
45 0.09
46 0.1
47 0.1
48 0.1
49 0.13
50 0.2
51 0.21
52 0.23
53 0.22
54 0.27
55 0.32
56 0.37
57 0.36
58 0.34
59 0.35
60 0.33
61 0.33
62 0.29
63 0.26
64 0.21
65 0.19
66 0.16
67 0.13
68 0.14
69 0.12
70 0.12
71 0.12
72 0.13
73 0.15
74 0.19
75 0.22
76 0.24
77 0.25
78 0.33
79 0.34
80 0.38
81 0.39
82 0.35
83 0.39
84 0.38
85 0.39
86 0.31
87 0.29
88 0.22
89 0.18
90 0.16
91 0.11
92 0.1
93 0.06
94 0.06
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.07
101 0.09
102 0.09
103 0.11
104 0.13
105 0.14
106 0.17
107 0.22
108 0.26
109 0.29
110 0.36
111 0.34
112 0.38
113 0.41
114 0.41
115 0.36
116 0.32
117 0.28
118 0.27
119 0.28
120 0.31
121 0.33
122 0.4
123 0.44
124 0.49
125 0.55
126 0.53
127 0.61
128 0.61
129 0.65
130 0.63
131 0.67
132 0.68
133 0.73
134 0.79
135 0.79
136 0.79
137 0.78
138 0.78
139 0.79
140 0.75
141 0.73
142 0.72
143 0.72
144 0.69
145 0.64
146 0.59
147 0.57
148 0.56
149 0.51
150 0.51
151 0.51
152 0.58
153 0.59
154 0.66
155 0.67
156 0.69
157 0.73
158 0.76
159 0.74
160 0.74
161 0.73
162 0.72
163 0.67
164 0.7
165 0.68
166 0.64
167 0.64
168 0.63
169 0.67
170 0.69
171 0.78
172 0.79
173 0.83
174 0.88
175 0.89
176 0.91
177 0.92
178 0.92
179 0.92
180 0.94