Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068RJN6

Protein Details
Accession A0A068RJN6    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
72-98HPDLCKSKPSCKPWQKPPYKNDHPSNIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, mito_nucl 13, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MAIAISQLRGAFALNHFKPRKATSASSKRKKSLTVTISKEPPVIHCIEQDKLECTFECIFDPLVRHDDESDHPDLCKSKPSCKPWQKPPYKNDHPSNIANVLRRLWVHPKIKDSNQPPKSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.34
3 0.35
4 0.38
5 0.42
6 0.43
7 0.46
8 0.41
9 0.46
10 0.47
11 0.57
12 0.65
13 0.7
14 0.74
15 0.72
16 0.69
17 0.67
18 0.62
19 0.61
20 0.58
21 0.57
22 0.56
23 0.58
24 0.57
25 0.54
26 0.5
27 0.4
28 0.33
29 0.28
30 0.24
31 0.19
32 0.19
33 0.2
34 0.2
35 0.21
36 0.2
37 0.19
38 0.17
39 0.18
40 0.14
41 0.15
42 0.15
43 0.13
44 0.13
45 0.12
46 0.11
47 0.11
48 0.12
49 0.1
50 0.12
51 0.12
52 0.11
53 0.11
54 0.12
55 0.13
56 0.17
57 0.17
58 0.15
59 0.15
60 0.16
61 0.17
62 0.16
63 0.23
64 0.21
65 0.28
66 0.36
67 0.43
68 0.53
69 0.62
70 0.7
71 0.73
72 0.82
73 0.83
74 0.84
75 0.85
76 0.85
77 0.84
78 0.85
79 0.81
80 0.78
81 0.72
82 0.66
83 0.62
84 0.57
85 0.5
86 0.45
87 0.39
88 0.33
89 0.3
90 0.29
91 0.29
92 0.31
93 0.37
94 0.41
95 0.45
96 0.52
97 0.57
98 0.63
99 0.68
100 0.69
101 0.72
102 0.71