Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068RX69

Protein Details
Accession A0A068RX69   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-43TTTSTGHHTTHKKHNRHHVKRRSAGRVHVTKBasic
66-90NNNGNHKRPHMRRSQSQRSLNRLSNHydrophilic
NLS Segment(s)
PositionSequence
25-35KHNRHHVKRRS
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018857  TORC1_cplx_su_TCO89  
Gene Ontology GO:0031931  C:TORC1 complex  
GO:0031929  P:TOR signaling  
Pfam View protein in Pfam  
PF10452  TCO89  
Amino Acid Sequences MAQPLAPPSPPTTTTSTGHHTTHKKHNRHHVKRRSAGRVHVTKLAPMARANTSHTDTEADIEHHDNNNGNHKRPHMRRSQSQRSLNRLSNGERKGGGGLTALAPIHPSKTSSAAAATTSSPPTTPSPPPSATENDEEEEEEQKQHHLNNNNTFYPPIQCIETTTTAATYPAFFVSSQAPAAPIEQTFNAVAKNLVSSNNTSHTSLPSIQPSSNHRSSQPLRSQFIDETIDIHHHHPKQRTPVTTAPTTTTTPPADANGKRLSNVAAAANAQPPGMSRTQQKLLLQRQHCLVDDENNLGHPKNMRRLTRELERVGREYQCVRRYHDPMMESLQRCLEQQQQQQQQPRMRLSQRTRSSAVLPTFTESAATTTTAHLEPHYEQRQAIHRRHLQLKMMAQQGHSHYHPVDPPPSPTQSAATGTLNIIRWSAGVLLDRVWNGSSSSYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.41
4 0.41
5 0.41
6 0.46
7 0.48
8 0.51
9 0.6
10 0.65
11 0.68
12 0.72
13 0.81
14 0.84
15 0.87
16 0.9
17 0.9
18 0.91
19 0.91
20 0.92
21 0.91
22 0.86
23 0.83
24 0.82
25 0.79
26 0.72
27 0.71
28 0.61
29 0.53
30 0.52
31 0.46
32 0.39
33 0.33
34 0.33
35 0.28
36 0.3
37 0.32
38 0.32
39 0.32
40 0.31
41 0.3
42 0.28
43 0.25
44 0.24
45 0.22
46 0.18
47 0.16
48 0.18
49 0.2
50 0.19
51 0.21
52 0.23
53 0.24
54 0.33
55 0.35
56 0.38
57 0.39
58 0.44
59 0.53
60 0.57
61 0.63
62 0.63
63 0.67
64 0.73
65 0.79
66 0.84
67 0.83
68 0.85
69 0.84
70 0.82
71 0.81
72 0.76
73 0.7
74 0.63
75 0.6
76 0.59
77 0.53
78 0.48
79 0.4
80 0.36
81 0.32
82 0.28
83 0.22
84 0.14
85 0.13
86 0.1
87 0.11
88 0.1
89 0.09
90 0.1
91 0.1
92 0.11
93 0.1
94 0.11
95 0.11
96 0.15
97 0.16
98 0.15
99 0.16
100 0.15
101 0.15
102 0.15
103 0.15
104 0.14
105 0.14
106 0.14
107 0.12
108 0.14
109 0.17
110 0.21
111 0.23
112 0.26
113 0.31
114 0.32
115 0.34
116 0.36
117 0.36
118 0.35
119 0.34
120 0.32
121 0.27
122 0.26
123 0.24
124 0.22
125 0.19
126 0.17
127 0.14
128 0.12
129 0.13
130 0.14
131 0.16
132 0.22
133 0.27
134 0.34
135 0.42
136 0.46
137 0.46
138 0.45
139 0.42
140 0.37
141 0.31
142 0.26
143 0.18
144 0.15
145 0.13
146 0.15
147 0.18
148 0.19
149 0.18
150 0.16
151 0.15
152 0.14
153 0.14
154 0.12
155 0.08
156 0.07
157 0.06
158 0.07
159 0.07
160 0.08
161 0.09
162 0.1
163 0.1
164 0.09
165 0.09
166 0.09
167 0.09
168 0.09
169 0.07
170 0.08
171 0.07
172 0.09
173 0.09
174 0.09
175 0.08
176 0.08
177 0.08
178 0.06
179 0.07
180 0.07
181 0.08
182 0.09
183 0.1
184 0.12
185 0.15
186 0.17
187 0.17
188 0.17
189 0.16
190 0.18
191 0.18
192 0.17
193 0.17
194 0.17
195 0.17
196 0.19
197 0.23
198 0.28
199 0.31
200 0.3
201 0.28
202 0.34
203 0.36
204 0.42
205 0.44
206 0.42
207 0.4
208 0.41
209 0.42
210 0.34
211 0.34
212 0.27
213 0.19
214 0.15
215 0.13
216 0.14
217 0.13
218 0.15
219 0.18
220 0.2
221 0.25
222 0.29
223 0.32
224 0.4
225 0.44
226 0.45
227 0.44
228 0.46
229 0.46
230 0.43
231 0.4
232 0.33
233 0.3
234 0.29
235 0.24
236 0.23
237 0.19
238 0.17
239 0.17
240 0.17
241 0.2
242 0.19
243 0.23
244 0.25
245 0.24
246 0.24
247 0.24
248 0.23
249 0.18
250 0.18
251 0.14
252 0.09
253 0.1
254 0.11
255 0.12
256 0.11
257 0.1
258 0.08
259 0.08
260 0.11
261 0.11
262 0.12
263 0.15
264 0.2
265 0.24
266 0.27
267 0.3
268 0.36
269 0.43
270 0.5
271 0.47
272 0.45
273 0.45
274 0.44
275 0.41
276 0.35
277 0.28
278 0.24
279 0.24
280 0.23
281 0.2
282 0.19
283 0.2
284 0.17
285 0.17
286 0.17
287 0.2
288 0.27
289 0.34
290 0.37
291 0.41
292 0.47
293 0.51
294 0.55
295 0.57
296 0.53
297 0.53
298 0.52
299 0.5
300 0.48
301 0.43
302 0.37
303 0.36
304 0.39
305 0.39
306 0.39
307 0.41
308 0.46
309 0.48
310 0.51
311 0.5
312 0.43
313 0.38
314 0.42
315 0.44
316 0.37
317 0.35
318 0.32
319 0.28
320 0.27
321 0.28
322 0.3
323 0.3
324 0.36
325 0.45
326 0.51
327 0.57
328 0.65
329 0.69
330 0.67
331 0.65
332 0.63
333 0.61
334 0.58
335 0.62
336 0.62
337 0.65
338 0.66
339 0.66
340 0.64
341 0.58
342 0.55
343 0.53
344 0.47
345 0.4
346 0.34
347 0.31
348 0.29
349 0.26
350 0.23
351 0.16
352 0.15
353 0.13
354 0.13
355 0.11
356 0.11
357 0.14
358 0.14
359 0.14
360 0.13
361 0.15
362 0.17
363 0.26
364 0.3
365 0.29
366 0.28
367 0.33
368 0.42
369 0.47
370 0.51
371 0.51
372 0.54
373 0.6
374 0.68
375 0.69
376 0.65
377 0.63
378 0.63
379 0.6
380 0.6
381 0.53
382 0.47
383 0.46
384 0.44
385 0.42
386 0.37
387 0.34
388 0.28
389 0.3
390 0.34
391 0.33
392 0.36
393 0.33
394 0.37
395 0.39
396 0.43
397 0.41
398 0.38
399 0.36
400 0.34
401 0.34
402 0.32
403 0.28
404 0.25
405 0.24
406 0.27
407 0.26
408 0.22
409 0.2
410 0.16
411 0.14
412 0.14
413 0.14
414 0.12
415 0.13
416 0.13
417 0.14
418 0.17
419 0.18
420 0.18
421 0.17
422 0.16
423 0.15