Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A068RFU7

Protein Details
Accession A0A068RFU7   
Localization Confidence High
Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
35-60ASEIFRKSKTEKKKFAKHTWYHFKCWHydrophilic
NLS Segment(s)
PositionSequence
119-125KTKEKKR
153-171AGKKRKAESIEKKKAEAPK
196-203KKSKKAKK
Subcellular Location(s) nucl 16.5, mito_nucl 10, cyto 6, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001510  Znf_PARP  
IPR036957  Znf_PARP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50064  ZF_PARP_2  
Amino Acid Sequences MSDQGITTYSVEYREKPGAKCAACSKSILAKSLAASEIFRKSKTEKKKFAKHTWYHFKCWTVPDMVTKLPIEQLRGYPSLVEKDQRLVQQLIERGAGAKWVDSTKKEDEEPVDTEKPAKTKEKKRSKTADLTSGLTGVQVAPVKNVTKLASNAGKKRKAESIEKKKAEAPKEESSLGKKDQLELESIAKEIQDALKKSKKAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.34
4 0.41
5 0.45
6 0.44
7 0.47
8 0.5
9 0.47
10 0.43
11 0.43
12 0.39
13 0.39
14 0.4
15 0.37
16 0.31
17 0.28
18 0.27
19 0.28
20 0.26
21 0.18
22 0.17
23 0.18
24 0.25
25 0.25
26 0.25
27 0.25
28 0.29
29 0.37
30 0.48
31 0.54
32 0.57
33 0.65
34 0.75
35 0.81
36 0.87
37 0.89
38 0.85
39 0.85
40 0.86
41 0.81
42 0.77
43 0.71
44 0.64
45 0.56
46 0.5
47 0.43
48 0.34
49 0.3
50 0.28
51 0.27
52 0.25
53 0.23
54 0.21
55 0.19
56 0.2
57 0.19
58 0.18
59 0.16
60 0.17
61 0.19
62 0.2
63 0.19
64 0.16
65 0.16
66 0.17
67 0.17
68 0.17
69 0.14
70 0.16
71 0.19
72 0.19
73 0.21
74 0.19
75 0.18
76 0.2
77 0.21
78 0.2
79 0.16
80 0.15
81 0.12
82 0.12
83 0.12
84 0.08
85 0.07
86 0.07
87 0.08
88 0.1
89 0.1
90 0.15
91 0.16
92 0.18
93 0.18
94 0.19
95 0.19
96 0.21
97 0.22
98 0.23
99 0.21
100 0.2
101 0.21
102 0.21
103 0.21
104 0.21
105 0.28
106 0.32
107 0.4
108 0.51
109 0.61
110 0.67
111 0.74
112 0.79
113 0.77
114 0.78
115 0.73
116 0.7
117 0.62
118 0.56
119 0.47
120 0.39
121 0.31
122 0.22
123 0.17
124 0.09
125 0.09
126 0.09
127 0.08
128 0.09
129 0.12
130 0.12
131 0.13
132 0.15
133 0.14
134 0.15
135 0.16
136 0.21
137 0.27
138 0.32
139 0.4
140 0.47
141 0.52
142 0.5
143 0.53
144 0.54
145 0.52
146 0.57
147 0.6
148 0.63
149 0.67
150 0.68
151 0.67
152 0.65
153 0.66
154 0.61
155 0.58
156 0.54
157 0.5
158 0.52
159 0.52
160 0.49
161 0.47
162 0.46
163 0.41
164 0.39
165 0.33
166 0.33
167 0.35
168 0.33
169 0.32
170 0.29
171 0.3
172 0.25
173 0.25
174 0.21
175 0.16
176 0.15
177 0.14
178 0.17
179 0.21
180 0.23
181 0.32
182 0.39
183 0.44